Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	56833
Gene name	SLAM family member 8
Gene symbol	SLAMF8
Synonyms (NCBI Gene)	BLAMECD353SBBI42
Chromosome	1
Chromosome location	1q23.2
Summary	This gene encodes a member of the CD2 family of cell surface proteins involved in lymphocyte activation. These proteins are characterized by Ig domains. This protein is expressed in lymphoid tissues, and studies of a similar protein in mouse suggest that

97 Show/Hide all (97)

miRTarBase ID	miRNA	Experiments
MIRT1351521	hsa-miR-1183	CLIP-seq
MIRT1351522	hsa-miR-1193	CLIP-seq
MIRT1351523	hsa-miR-1207-5p	CLIP-seq
MIRT1351524	hsa-miR-145	CLIP-seq
MIRT1351525	hsa-miR-146a	CLIP-seq
MIRT1351526	hsa-miR-146b-5p	CLIP-seq
MIRT1351527	hsa-miR-1825	CLIP-seq
MIRT1351528	hsa-miR-199a-5p	CLIP-seq
MIRT1351529	hsa-miR-199b-5p	CLIP-seq
MIRT1351530	hsa-miR-3179	CLIP-seq
MIRT1351531	hsa-miR-3202	CLIP-seq
MIRT1351532	hsa-miR-3612	CLIP-seq
MIRT1351533	hsa-miR-3665	CLIP-seq
MIRT1351534	hsa-miR-3689d	CLIP-seq
MIRT1351535	hsa-miR-3690	CLIP-seq
MIRT1351536	hsa-miR-3691-5p	CLIP-seq
MIRT1351537	hsa-miR-4254	CLIP-seq
MIRT1351538	hsa-miR-4434	CLIP-seq
MIRT1351539	hsa-miR-4443	CLIP-seq
MIRT1351540	hsa-miR-4450	CLIP-seq
MIRT1351541	hsa-miR-4516	CLIP-seq
MIRT1351542	hsa-miR-4531	CLIP-seq
MIRT1351543	hsa-miR-4716-3p	CLIP-seq
MIRT1351544	hsa-miR-4723-5p	CLIP-seq
MIRT1351545	hsa-miR-4736	CLIP-seq
MIRT1351546	hsa-miR-4747-5p	CLIP-seq
MIRT1351547	hsa-miR-4752	CLIP-seq
MIRT1351548	hsa-miR-4763-3p	CLIP-seq
MIRT1351549	hsa-miR-4782-5p	CLIP-seq
MIRT1351550	hsa-miR-491-5p	CLIP-seq
MIRT1351551	hsa-miR-516b	CLIP-seq
MIRT1351552	hsa-miR-650	CLIP-seq
MIRT2104202	hsa-miR-1343	CLIP-seq
MIRT1351524	hsa-miR-145	CLIP-seq
MIRT2104203	hsa-miR-3074-5p	CLIP-seq
MIRT2104204	hsa-miR-3180-5p	CLIP-seq
MIRT2104205	hsa-miR-330-3p	CLIP-seq
MIRT2104206	hsa-miR-371-5p	CLIP-seq
MIRT2104207	hsa-miR-371b-5p	CLIP-seq
MIRT2104208	hsa-miR-412	CLIP-seq
MIRT2104209	hsa-miR-4422	CLIP-seq
MIRT1351544	hsa-miR-4723-5p	CLIP-seq
MIRT2104210	hsa-miR-486-3p	CLIP-seq
MIRT2104211	hsa-miR-584	CLIP-seq
MIRT2104212	hsa-miR-595	CLIP-seq
MIRT2328343	hsa-miR-1182	CLIP-seq
MIRT2328344	hsa-miR-1205	CLIP-seq
MIRT2328345	hsa-miR-1255a	CLIP-seq
MIRT2328346	hsa-miR-1255b	CLIP-seq
MIRT2328347	hsa-miR-1587	CLIP-seq
MIRT2328348	hsa-miR-1909	CLIP-seq
MIRT2328349	hsa-miR-193a-5p	CLIP-seq
MIRT2328350	hsa-miR-2355-3p	CLIP-seq
MIRT2104203	hsa-miR-3074-5p	CLIP-seq
MIRT2328351	hsa-miR-3127-5p	CLIP-seq
MIRT2328352	hsa-miR-3147	CLIP-seq
MIRT2328353	hsa-miR-3151	CLIP-seq
MIRT2328354	hsa-miR-3153	CLIP-seq
MIRT2104206	hsa-miR-371-5p	CLIP-seq
MIRT2104207	hsa-miR-371b-5p	CLIP-seq
MIRT2328355	hsa-miR-4328	CLIP-seq
MIRT2328356	hsa-miR-4418	CLIP-seq
MIRT2328357	hsa-miR-4425	CLIP-seq
MIRT2328358	hsa-miR-4447	CLIP-seq
MIRT2328359	hsa-miR-4472	CLIP-seq
MIRT2328360	hsa-miR-4492	CLIP-seq
MIRT2328361	hsa-miR-4498	CLIP-seq
MIRT2328362	hsa-miR-4646-3p	CLIP-seq
MIRT2328363	hsa-miR-4648	CLIP-seq
MIRT2328364	hsa-miR-4649-3p	CLIP-seq
MIRT2328365	hsa-miR-4654	CLIP-seq
MIRT2328366	hsa-miR-4656	CLIP-seq
MIRT2328367	hsa-miR-4667-5p	CLIP-seq
MIRT2328368	hsa-miR-4668-5p	CLIP-seq
MIRT2328369	hsa-miR-4674	CLIP-seq
MIRT2328370	hsa-miR-4675	CLIP-seq
MIRT2328371	hsa-miR-4688	CLIP-seq
MIRT2328372	hsa-miR-4695-3p	CLIP-seq
MIRT2328373	hsa-miR-4700-5p	CLIP-seq
MIRT2328374	hsa-miR-4741	CLIP-seq
MIRT2328375	hsa-miR-4769-5p	CLIP-seq
MIRT2104210	hsa-miR-486-3p	CLIP-seq
MIRT1351550	hsa-miR-491-5p	CLIP-seq
MIRT2328376	hsa-miR-509-3-5p	CLIP-seq
MIRT2328377	hsa-miR-509-5p	CLIP-seq
MIRT2328378	hsa-miR-580	CLIP-seq
MIRT2328379	hsa-miR-615-5p	CLIP-seq
MIRT2328380	hsa-miR-637	CLIP-seq
MIRT2328381	hsa-miR-647	CLIP-seq
MIRT2328382	hsa-miR-762	CLIP-seq
MIRT2328344	hsa-miR-1205	CLIP-seq
MIRT2394597	hsa-miR-1286	CLIP-seq
MIRT2394598	hsa-miR-558	CLIP-seq
MIRT2328351	hsa-miR-3127-5p	CLIP-seq
MIRT2459450	hsa-miR-4305	CLIP-seq
MIRT2328371	hsa-miR-4688	CLIP-seq
MIRT2104210	hsa-miR-486-3p	CLIP-seq

17 Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002232	Process	Leukocyte chemotaxis involved in inflammatory response	ISS
GO:0002336	Process	B-1 B cell lineage commitment	ISS	11313408
GO:0005515	Function	Protein binding	IPI	32296183, 33961781
GO:0006955	Process	Immune response	IBA
GO:0009986	Component	Cell surface	NAS	11313408
GO:0010760	Process	Negative regulation of macrophage chemotaxis	ISS
GO:0016020	Component	Membrane	IEA
GO:0038023	Function	Signaling receptor activity	IBA
GO:0038023	Function	Signaling receptor activity	ISS
GO:0042742	Process	Defense response to bacterium	ISS
GO:0042802	Function	Identical protein binding	ISS
GO:0045577	Process	Regulation of B cell differentiation	ISS	11313408
GO:0060266	Process	Negative regulation of respiratory burst involved in inflammatory response	ISS
GO:0090027	Process	Negative regulation of monocyte chemotaxis	ISS
GO:0090383	Process	Phagosome acidification	ISS
GO:1902623	Process	Negative regulation of neutrophil migration	ISS
GO:2000509	Process	Negative regulation of dendritic cell chemotaxis	ISS

MIM	HGNC	e!Ensembl
606620	21391	ENSG00000158714

Q9P0V8

Protein name

SLAM family member 8 (B-lymphocyte activator macrophage expressed) (BCM-like membrane protein) (CD antigen CD353)

Protein function

May play a role in B-lineage commitment and/or modulation of signaling through the B-cell receptor.

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Expressed in lymph node, spleen, thymus and bone marrow. {ECO:0000269|PubMed:11313408}.

Sequence

MVMRPLWSLLLWEALLPITVTGAQVLSKVGGSVLLVAARPPGFQVREAIWRSLWPSEELL
ATFFRGSLETLYHSRFLGRAQLHSNLSLELGPLESGDSGNFSVLMVDTRGQPWTQTLQLK
VYDAVPRPVVQVFIAVERDAQPSKTCQVFLSCWAPNISEITYSWRRETTMDFGMEPHSLF
TDGQVLSISLGPGDRDVAYSCIVSNPVSWDLATVTPWDSCHHEAAPGKASYKDVLLVVVP
VSLLLMLVTLFSAWHWCPCSGKKKKDVHADRVGPETENPLVQDLP

Sequence length

285

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (6)
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	28067908, 37156999	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	28067908, 37156999	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	CTD, Disgenet CTD, Disgenet	28067908	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	37156999	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (12)
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35506438	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	36304068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	28067908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30105842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30105842	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	30105842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	30105842	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	CTD_human_DG	28067908		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30105842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	29498772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	38017548	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30873760	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SLAMF8 (SLAM family member 8)

Save This Analysis