SIRT5 (sirtuin 5)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 23408
• Gene name: Sirtuin 5
• Gene symbol: SIRT5
• Synonyms (NCBI Gene): SIR2L5
• Chromosome: 6
• Chromosome location: 6p23
• Summary: This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been det

miRNA Show/Hide all (232)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018521	hsa-miR-335-5p	Microarray	18185580
MIRT1350242	hsa-miR-10a	CLIP-seq
MIRT1350243	hsa-miR-10b	CLIP-seq
MIRT1350244	hsa-miR-125a-5p	CLIP-seq
MIRT1350245	hsa-miR-125b	CLIP-seq
MIRT1350246	hsa-miR-141	CLIP-seq
MIRT1350247	hsa-miR-142-5p	CLIP-seq
MIRT1350248	hsa-miR-19a	CLIP-seq
MIRT1350249	hsa-miR-19b	CLIP-seq
MIRT1350250	hsa-miR-200a	CLIP-seq
MIRT1350251	hsa-miR-324-5p	CLIP-seq
MIRT1350252	hsa-miR-331-3p	CLIP-seq
MIRT1350253	hsa-miR-3646	CLIP-seq
MIRT1350254	hsa-miR-3662	CLIP-seq
MIRT1350255	hsa-miR-4251	CLIP-seq
MIRT1350256	hsa-miR-4319	CLIP-seq
MIRT1350257	hsa-miR-4324	CLIP-seq
MIRT1350258	hsa-miR-4496	CLIP-seq
MIRT1350259	hsa-miR-4503	CLIP-seq
MIRT1350260	hsa-miR-4704-5p	CLIP-seq
MIRT1350261	hsa-miR-4725-5p	CLIP-seq
MIRT1350262	hsa-miR-504	CLIP-seq
MIRT1350263	hsa-miR-548c-3p	CLIP-seq
MIRT1350264	hsa-miR-561	CLIP-seq
MIRT1350265	hsa-miR-580	CLIP-seq
MIRT1350266	hsa-miR-2467-5p	CLIP-seq
MIRT1350267	hsa-miR-3188	CLIP-seq
MIRT1350268	hsa-miR-3691-3p	CLIP-seq
MIRT1350269	hsa-miR-382	CLIP-seq
MIRT1350270	hsa-miR-3929	CLIP-seq
MIRT1350271	hsa-miR-3975	CLIP-seq
MIRT1350272	hsa-miR-4419b	CLIP-seq
MIRT1350273	hsa-miR-4478	CLIP-seq
MIRT1350274	hsa-miR-450b-5p	CLIP-seq
MIRT1350275	hsa-miR-4639-5p	CLIP-seq
MIRT1350276	hsa-miR-4649-3p	CLIP-seq
MIRT1350277	hsa-miR-4656	CLIP-seq
MIRT1350278	hsa-miR-4708-3p	CLIP-seq
MIRT1350279	hsa-miR-485-5p	CLIP-seq
MIRT1350280	hsa-miR-507	CLIP-seq
MIRT1350281	hsa-miR-557	CLIP-seq
MIRT1350282	hsa-miR-576-3p	CLIP-seq
MIRT1350246	hsa-miR-141	CLIP-seq
MIRT1350247	hsa-miR-142-5p	CLIP-seq
MIRT1350283	hsa-miR-197	CLIP-seq
MIRT1350250	hsa-miR-200a	CLIP-seq
MIRT1350284	hsa-miR-216a	CLIP-seq
MIRT1350285	hsa-miR-216b	CLIP-seq
MIRT1350286	hsa-miR-24	CLIP-seq
MIRT1350266	hsa-miR-2467-5p	CLIP-seq
MIRT1350287	hsa-miR-3122	CLIP-seq
MIRT1350288	hsa-miR-3168	CLIP-seq
MIRT1350267	hsa-miR-3188	CLIP-seq
MIRT1350289	hsa-miR-3622a-3p	CLIP-seq
MIRT1350290	hsa-miR-3622b-3p	CLIP-seq
MIRT1350253	hsa-miR-3646	CLIP-seq
MIRT1350254	hsa-miR-3662	CLIP-seq
MIRT1350291	hsa-miR-3667-5p	CLIP-seq
MIRT1350292	hsa-miR-3689a-3p	CLIP-seq
MIRT1350293	hsa-miR-3689c	CLIP-seq
MIRT1350294	hsa-miR-3913-5p	CLIP-seq
MIRT1350270	hsa-miR-3929	CLIP-seq
MIRT1350271	hsa-miR-3975	CLIP-seq
MIRT1350295	hsa-miR-4279	CLIP-seq
MIRT1350296	hsa-miR-4284	CLIP-seq
MIRT1350297	hsa-miR-4293	CLIP-seq
MIRT1350272	hsa-miR-4419b	CLIP-seq
MIRT1350298	hsa-miR-4434	CLIP-seq
MIRT1350299	hsa-miR-4445	CLIP-seq
MIRT1350300	hsa-miR-4466	CLIP-seq
MIRT1350273	hsa-miR-4478	CLIP-seq
MIRT1350258	hsa-miR-4496	CLIP-seq
MIRT1350301	hsa-miR-4516	CLIP-seq
MIRT1350302	hsa-miR-4517	CLIP-seq
MIRT1350303	hsa-miR-4520a-5p	CLIP-seq
MIRT1350304	hsa-miR-4520b-5p	CLIP-seq
MIRT1350305	hsa-miR-4531	CLIP-seq
MIRT1350306	hsa-miR-4677-3p	CLIP-seq
MIRT1350307	hsa-miR-4684-5p	CLIP-seq
MIRT1350260	hsa-miR-4704-5p	CLIP-seq
MIRT1350308	hsa-miR-4728-5p	CLIP-seq
MIRT1350309	hsa-miR-4746-3p	CLIP-seq
MIRT1350310	hsa-miR-4802-3p	CLIP-seq
MIRT1350279	hsa-miR-485-5p	CLIP-seq
MIRT1350311	hsa-miR-510	CLIP-seq
MIRT1350312	hsa-miR-512-5p	CLIP-seq
MIRT1350313	hsa-miR-544b	CLIP-seq
MIRT1350263	hsa-miR-548c-3p	CLIP-seq
MIRT1350264	hsa-miR-561	CLIP-seq
MIRT1350314	hsa-miR-644	CLIP-seq
MIRT1350315	hsa-miR-658	CLIP-seq
MIRT1350316	hsa-miR-663b	CLIP-seq
MIRT1350317	hsa-miR-675	CLIP-seq
MIRT2103745	hsa-miR-1183	CLIP-seq
MIRT2103746	hsa-miR-1197	CLIP-seq
MIRT1350244	hsa-miR-125a-5p	CLIP-seq
MIRT1350245	hsa-miR-125b	CLIP-seq
MIRT2103747	hsa-miR-1285	CLIP-seq
MIRT1350283	hsa-miR-197	CLIP-seq
MIRT1350248	hsa-miR-19a	CLIP-seq
MIRT1350249	hsa-miR-19b	CLIP-seq
MIRT2103748	hsa-miR-208a	CLIP-seq
MIRT2103749	hsa-miR-208b	CLIP-seq
MIRT1350284	hsa-miR-216a	CLIP-seq
MIRT1350285	hsa-miR-216b	CLIP-seq
MIRT2103750	hsa-miR-2355-5p	CLIP-seq
MIRT2103751	hsa-miR-3156-3p	CLIP-seq
MIRT2103752	hsa-miR-3162-3p	CLIP-seq
MIRT2103753	hsa-miR-3187-5p	CLIP-seq
MIRT2103754	hsa-miR-323-5p	CLIP-seq
MIRT2103755	hsa-miR-3658	CLIP-seq
MIRT1350291	hsa-miR-3667-5p	CLIP-seq
MIRT2103756	hsa-miR-3675-3p	CLIP-seq
MIRT2103757	hsa-miR-421	CLIP-seq
MIRT2103758	hsa-miR-4257	CLIP-seq
MIRT1350297	hsa-miR-4293	CLIP-seq
MIRT1350256	hsa-miR-4319	CLIP-seq
MIRT1350257	hsa-miR-4324	CLIP-seq
MIRT1350298	hsa-miR-4434	CLIP-seq
MIRT2103759	hsa-miR-4436a	CLIP-seq
MIRT2103760	hsa-miR-4455	CLIP-seq
MIRT1350301	hsa-miR-4516	CLIP-seq
MIRT1350305	hsa-miR-4531	CLIP-seq
MIRT2103761	hsa-miR-4659a-3p	CLIP-seq
MIRT2103762	hsa-miR-4659b-3p	CLIP-seq
MIRT1350307	hsa-miR-4684-5p	CLIP-seq
MIRT2103763	hsa-miR-4709-5p	CLIP-seq
MIRT2103764	hsa-miR-4732-5p	CLIP-seq
MIRT2103765	hsa-miR-4738-3p	CLIP-seq
MIRT2103766	hsa-miR-4793-3p	CLIP-seq
MIRT1350310	hsa-miR-4802-3p	CLIP-seq
MIRT2103767	hsa-miR-499-5p	CLIP-seq
MIRT2103768	hsa-miR-508-5p	CLIP-seq
MIRT2103769	hsa-miR-513a-3p	CLIP-seq
MIRT1350263	hsa-miR-548c-3p	CLIP-seq
MIRT2103770	hsa-miR-574-5p	CLIP-seq
MIRT2103771	hsa-miR-609	CLIP-seq
MIRT2103772	hsa-miR-612	CLIP-seq
MIRT2103773	hsa-miR-661	CLIP-seq
MIRT2103774	hsa-miR-766	CLIP-seq
MIRT2103775	hsa-miR-876-3p	CLIP-seq
MIRT2103746	hsa-miR-1197	CLIP-seq
MIRT2327907	hsa-miR-1207-3p	CLIP-seq
MIRT1350244	hsa-miR-125a-5p	CLIP-seq
MIRT1350245	hsa-miR-125b	CLIP-seq
MIRT2103747	hsa-miR-1285	CLIP-seq
MIRT2327908	hsa-miR-140-3p	CLIP-seq
MIRT1350246	hsa-miR-141	CLIP-seq
MIRT1350247	hsa-miR-142-5p	CLIP-seq
MIRT2327909	hsa-miR-1538	CLIP-seq
MIRT1350250	hsa-miR-200a	CLIP-seq
MIRT1350284	hsa-miR-216a	CLIP-seq
MIRT1350285	hsa-miR-216b	CLIP-seq
MIRT2103750	hsa-miR-2355-5p	CLIP-seq
MIRT1350286	hsa-miR-24	CLIP-seq
MIRT2327910	hsa-miR-3065-3p	CLIP-seq
MIRT2327911	hsa-miR-3117-5p	CLIP-seq
MIRT1350287	hsa-miR-3122	CLIP-seq
MIRT2327912	hsa-miR-3160-3p	CLIP-seq
MIRT2103753	hsa-miR-3187-5p	CLIP-seq
MIRT2103754	hsa-miR-323-5p	CLIP-seq
MIRT2327913	hsa-miR-3613-3p	CLIP-seq
MIRT1350289	hsa-miR-3622a-3p	CLIP-seq
MIRT1350290	hsa-miR-3622b-3p	CLIP-seq
MIRT1350253	hsa-miR-3646	CLIP-seq
MIRT1350254	hsa-miR-3662	CLIP-seq
MIRT2327914	hsa-miR-3663-5p	CLIP-seq
MIRT1350292	hsa-miR-3689a-3p	CLIP-seq
MIRT1350293	hsa-miR-3689c	CLIP-seq
MIRT1350294	hsa-miR-3913-5p	CLIP-seq
MIRT2327915	hsa-miR-3914	CLIP-seq
MIRT1350271	hsa-miR-3975	CLIP-seq
MIRT2103758	hsa-miR-4257	CLIP-seq
MIRT2327916	hsa-miR-4263	CLIP-seq
MIRT1350296	hsa-miR-4284	CLIP-seq
MIRT2327917	hsa-miR-4290	CLIP-seq
MIRT1350256	hsa-miR-4319	CLIP-seq
MIRT2327918	hsa-miR-432	CLIP-seq
MIRT1350257	hsa-miR-4324	CLIP-seq
MIRT2327919	hsa-miR-4329	CLIP-seq
MIRT2103759	hsa-miR-4436a	CLIP-seq
MIRT2103760	hsa-miR-4455	CLIP-seq
MIRT2327920	hsa-miR-4487	CLIP-seq
MIRT2327921	hsa-miR-4494	CLIP-seq
MIRT1350258	hsa-miR-4496	CLIP-seq
MIRT2327922	hsa-miR-4527	CLIP-seq
MIRT2327923	hsa-miR-4539	CLIP-seq
MIRT2103761	hsa-miR-4659a-3p	CLIP-seq
MIRT2103762	hsa-miR-4659b-3p	CLIP-seq
MIRT1350306	hsa-miR-4677-3p	CLIP-seq
MIRT1350260	hsa-miR-4704-5p	CLIP-seq
MIRT2327924	hsa-miR-4719	CLIP-seq
MIRT1350308	hsa-miR-4728-5p	CLIP-seq
MIRT2327925	hsa-miR-4732-3p	CLIP-seq
MIRT2327926	hsa-miR-4745-3p	CLIP-seq
MIRT2103766	hsa-miR-4793-3p	CLIP-seq
MIRT2327927	hsa-miR-4796-5p	CLIP-seq
MIRT2327928	hsa-miR-499a-5p	CLIP-seq
MIRT2103768	hsa-miR-508-5p	CLIP-seq
MIRT1350313	hsa-miR-544b	CLIP-seq
MIRT2327929	hsa-miR-558	CLIP-seq
MIRT1350264	hsa-miR-561	CLIP-seq
MIRT2327930	hsa-miR-576-5p	CLIP-seq
MIRT2103771	hsa-miR-609	CLIP-seq
MIRT2103772	hsa-miR-612	CLIP-seq
MIRT2327931	hsa-miR-646	CLIP-seq
MIRT2327932	hsa-miR-654-3p	CLIP-seq
MIRT2103773	hsa-miR-661	CLIP-seq
MIRT2327933	hsa-miR-670	CLIP-seq
MIRT2103774	hsa-miR-766	CLIP-seq
MIRT2327934	hsa-miR-873	CLIP-seq
MIRT2103775	hsa-miR-876-3p	CLIP-seq
MIRT2327935	hsa-miR-890	CLIP-seq
MIRT2394562	hsa-miR-383	CLIP-seq
MIRT2103759	hsa-miR-4436a	CLIP-seq
MIRT2394563	hsa-miR-4700-3p	CLIP-seq
MIRT2394564	hsa-miR-4772-5p	CLIP-seq
MIRT2394565	hsa-miR-935	CLIP-seq
MIRT2442629	hsa-miR-1303	CLIP-seq
MIRT2103760	hsa-miR-4455	CLIP-seq
MIRT1350307	hsa-miR-4684-5p	CLIP-seq
MIRT1350279	hsa-miR-485-5p	CLIP-seq
MIRT1350263	hsa-miR-548c-3p	CLIP-seq
MIRT2103771	hsa-miR-609	CLIP-seq
MIRT2622894	hsa-miR-1322	CLIP-seq
MIRT2622895	hsa-miR-3682-3p	CLIP-seq
MIRT2622896	hsa-miR-4422	CLIP-seq
MIRT2622897	hsa-miR-4480	CLIP-seq
MIRT2622894	hsa-miR-1322	CLIP-seq
MIRT2622895	hsa-miR-3682-3p	CLIP-seq
MIRT2622896	hsa-miR-4422	CLIP-seq
MIRT2622897	hsa-miR-4480	CLIP-seq

Gene ontology (GO) Show/Hide all (53)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002931	Process	Response to ischemia	IEA
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	TAS	17456799
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	23806337
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	16079181, 23806337
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005758	Component	Mitochondrial intermembrane space	IDA	18680753
GO:0005758	Component	Mitochondrial intermembrane space	IEA
GO:0005759	Component	Mitochondrial matrix	IBA
GO:0005759	Component	Mitochondrial matrix	IDA	18680753
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	23806337
GO:0005829	Component	Cytosol	IEA
GO:0006476	Process	Protein deacetylation	IDA	22076378
GO:0006476	Process	Protein deacetylation	IDA	18680753
GO:0007005	Process	Mitochondrion organization	TAS
GO:0008270	Function	Zinc ion binding	IDA	22076378
GO:0008270	Function	Zinc ion binding	IEA
GO:0010566	Process	Regulation of ketone biosynthetic process	IEA
GO:0010566	Process	Regulation of ketone biosynthetic process	ISS
GO:0010667	Process	Negative regulation of cardiac muscle cell apoptotic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016747	Function	Acyltransferase activity, transferring groups other than amino-acyl groups	IEA
GO:0017136	Function	Histone deacetylase activity, NAD-dependent	IBA
GO:0031667	Process	Response to nutrient levels	IEA
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	IEA
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	TAS
GO:0036046	Process	Protein demalonylation	IDA	24703693
GO:0036047	Process	Peptidyl-lysine demalonylation	IDA	21908771, 22076378
GO:0036048	Process	Protein desuccinylation	IDA	24140062, 24703693, 29180469
GO:0036049	Process	Peptidyl-lysine desuccinylation	IDA	21908771, 22076378
GO:0036054	Function	Protein-malonyllysine demalonylase activity	IBA
GO:0036054	Function	Protein-malonyllysine demalonylase activity	IDA	21908771, 22076378, 24703693
GO:0036054	Function	Protein-malonyllysine demalonylase activity	IEA
GO:0036055	Function	Protein-succinyllysine desuccinylase activity	IBA
GO:0036055	Function	Protein-succinyllysine desuccinylase activity	IDA	21908771, 22076378, 24140062, 24703693, 29180469
GO:0036055	Function	Protein-succinyllysine desuccinylase activity	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0061697	Function	Protein-glutaryllysine deglutarylase activity	IBA
GO:0061697	Function	Protein-glutaryllysine deglutarylase activity	IDA	24703693
GO:0061697	Function	Protein-glutaryllysine deglutarylase activity	IEA
GO:0061698	Process	Protein deglutarylation	IDA	24703693
GO:0070403	Function	NAD+ binding	IDA	21908771, 22076378
GO:0070403	Function	NAD+ binding	IEA
GO:1990404	Function	NAD+-protein mono-ADP-ribosyltransferase activity	TAS	17456799
GO:2000378	Process	Negative regulation of reactive oxygen species metabolic process	IDA	24140062

Other IDs

• MIM: 604483
• HGNC: 14933
• e!Ensembl: ENSG00000124523

Protein

• UniProt ID: Q9NXA8
• Protein name: NAD-dependent protein deacylase sirtuin-5, mitochondrial (EC 2.3.1.-) (Regulatory protein SIR2 homolog 5) (SIR2-like protein 5)
• Protein function: NAD-dependent lysine demalonylase, desuccinylase and deglutarylase that specifically removes malonyl, succinyl and glutaryl groups on target proteins (PubMed:21908771, PubMed:22076378, PubMed:24703693, PubMed:29180469). Activates CPS1 and contri
• PDB: 2B4Y , 2NYR , 3RIG , 3RIY , 4F4U , 4F56 , 4G1C , 4HDA , 5BWL , 5XHS , 6ACE , 6ACL , 6ACO , 6ACP , 6EQS , 6LJK , 6LJM , 6LJN , 7X3P , 8GBL , 8GBN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02146	SIR2	58 → 256	Sir2 family	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:10381378}.
• Sequence:

  MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAG
  VSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRA
  IAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPI
  CPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELA
  HCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEA
  LACHENETVS

• Sequence length: 310

Pathways

KEGG Pathway	Reactome Pathway
Nicotinate and nicotinamide metabolism	Transcriptional activation of mitochondrial biogenesis
Metabolic pathways

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (10)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Adrenocortical carcinoma, hereditary	not provided	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	not provided	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	not provided	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	not provided	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	not provided	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SIRT5-related disorder	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	not provided	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	not provided	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	not provided	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (73)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	22796962		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	29622432		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29565454, 31843902		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23800187, 29416026	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30909186, 34930316	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	26631040	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36308411, 37068178, 38548246	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25070488, 26658802		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26121130	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33455080	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34930316, 37096064	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37976568	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31456942, 31572453		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29622432		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28614718		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29416026, 29514096, 30443978		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29416026, 36253417	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30703481		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29981421		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22087257	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30846716		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21331741, 30116390, 30279144		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	30846716		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26701732		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	26701732	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	39596570	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30909186		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30909186	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30909186		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36809279	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30846716		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	22087257	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30904607		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	36717793	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31815138		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	34027418	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29115436, 29491006, 30170358, 30662803, 31333804		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	39596570	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	39596570	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26658802, 39375419	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29565454, 31843902		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26701732		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29491006		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25070488, 26658802		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31456942, 31572453		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29088792, 31247190		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27858336, 28707979, 29180469, 31161996		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	31843902		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30471144		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	16827919		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30279144		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	20887790	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28036303, 29180469, 29637793, 30471144		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	20887790		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	27577743		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29637793		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25070488		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30279144		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31456942, 31572453		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32541517	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	20887790	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	27858336		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33103371, 34949659	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35278714	Inhibit	★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	16827919		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	16827919		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28461090, 31632409		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30237737		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23475622	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29088792, 31247190		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29896817, 33530803	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	35136826	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29565454		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

SIRT4 2 shared pathwaysNicotinate and nicotinamide metabolism, Transcriptional activation of mitochondrial biogenesis Related via 2 shared pathways including Nicotinate and nicotinamide metabolism, Transcriptional activation of mitochondrial biogenesis. SIRT3 2 shared pathwaysNicotinate and nicotinamide metabolism, Transcriptional activation of mitochondrial biogenesis Related via 2 shared pathways including Nicotinate and nicotinamide metabolism, Transcriptional activation of mitochondrial biogenesis.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
SIRT4	0	[]	2	["Nicotinate and nicotinamide metabolism","Transcriptional activation of mitochondrial biogenesis"]	0	[]
SIRT3	0	[]	2	["Nicotinate and nicotinamide metabolism","Transcriptional activation of mitochondrial biogenesis"]	0	[]

Diseases Linked via Similar Genes

Alzheimer disease Linked via 1 of 2 related genesSIRT4 Cardiomegaly Linked via 1 of 2 related genesSIRT4 Neurodevelopmental disorder Linked via 1 of 2 related genesSIRT4 Benign prostatic hyperplasia Linked via 1 of 2 related genesSIRT3 Brain aneurysm Linked via 1 of 2 related genesSIRT3

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Alzheimer disease	1	["SIRT4"]
Cardiomegaly	1	["SIRT4"]
Neurodevelopmental disorder	1	["SIRT4"]
Benign prostatic hyperplasia	1	["SIRT3"]
Brain aneurysm	1	["SIRT3"]