SEC63 (SEC63 protein translocation regulator)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 11231
• Gene name: SEC63 protein translocation regulator
• Gene symbol: SEC63
• Synonyms (NCBI Gene): DNAJC23, ERdj2, PCLD2, PRO2507, SEC63L
• Chromosome: 6
• Chromosome location: 6q21
• Summary: The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. The protein encoded by this gene and SEC62 protein are found to be associated with ribosome-free SEC61 complex. It is speculated

SNPs Show/Hide all (10)

SNP ID	Visualize variation	Clinical significance	Consequence
rs119103233	C>T	Pathogenic	5 prime UTR variant, stop gained, coding sequence variant
rs727504146	G>-	Pathogenic	5 prime UTR variant, frameshift variant, coding sequence variant
rs752018806	TTC>-	Conflicting-interpretations-of-pathogenicity, pathogenic	Coding sequence variant, inframe deletion
rs752868449	T>-,TT	Pathogenic	Coding sequence variant, frameshift variant
rs766716921	->A,AA,AAA,AAAA,AAAAA	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Intron variant
rs869312977	C>T	Likely-pathogenic, pathogenic	Splice donor variant
rs869312978	C>-	Pathogenic	5 prime UTR variant, coding sequence variant, stop gained
rs886041027	->T	Pathogenic	5 prime UTR variant, frameshift variant, coding sequence variant
rs886041028	C>T	Pathogenic	Splice donor variant
rs1554236269	C>T	Pathogenic	Splice donor variant

miRNA Show/Hide all (703)

miRTarBase ID	miRNA	Experiments	Reference
MIRT026665	hsa-miR-192-5p	Microarray	19074876
MIRT030915	hsa-miR-21-5p	Microarray	18591254
MIRT051342	hsa-miR-15a-5p	CLASH	23622248
MIRT038691	hsa-miR-30c-2-3p	CLASH	23622248
MIRT038508	hsa-miR-296-3p	CLASH	23622248
MIRT614782	hsa-miR-4318	HITS-CLIP	23824327
MIRT610591	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT544275	hsa-miR-4503	HITS-CLIP	23824327
MIRT622327	hsa-miR-3675-3p	HITS-CLIP	23824327
MIRT622326	hsa-miR-4528	HITS-CLIP	23824327
MIRT497435	hsa-miR-1470	HITS-CLIP	23824327
MIRT497434	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT622325	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT622324	hsa-miR-4469	HITS-CLIP	23824327
MIRT622323	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT622322	hsa-miR-4287	HITS-CLIP	23824327
MIRT622321	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT622320	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT622319	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT622318	hsa-miR-6083	HITS-CLIP	23824327
MIRT622317	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT614782	hsa-miR-4318	HITS-CLIP	23824327
MIRT610591	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT544275	hsa-miR-4503	HITS-CLIP	23824327
MIRT610590	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT614782	hsa-miR-4318	HITS-CLIP	23824327
MIRT610591	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT544275	hsa-miR-4503	HITS-CLIP	23824327
MIRT610590	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT614782	hsa-miR-4318	HITS-CLIP	23824327
MIRT610591	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT544275	hsa-miR-4503	HITS-CLIP	23824327
MIRT610590	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT636255	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT636255	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT636254	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT636253	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT636252	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT636251	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT636250	hsa-miR-4252	HITS-CLIP	23824327
MIRT636249	hsa-miR-1254	HITS-CLIP	23824327
MIRT636248	hsa-miR-3116	HITS-CLIP	23824327
MIRT636247	hsa-miR-1227-3p	HITS-CLIP	23824327
MIRT636246	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT636245	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT636244	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT636243	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT636242	hsa-miR-7703	HITS-CLIP	23824327
MIRT614782	hsa-miR-4318	HITS-CLIP	23824327
MIRT610591	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT544275	hsa-miR-4503	HITS-CLIP	23824327
MIRT610590	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT614782	hsa-miR-4318	HITS-CLIP	23824327
MIRT610591	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT544275	hsa-miR-4503	HITS-CLIP	23824327
MIRT610590	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT622336	hsa-miR-5003-3p	HITS-CLIP	23824327
MIRT622335	hsa-miR-6508-5p	HITS-CLIP	23824327
MIRT622334	hsa-miR-8067	HITS-CLIP	23824327
MIRT622333	hsa-miR-4635	HITS-CLIP	23824327
MIRT622332	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT622331	hsa-miR-526b-5p	HITS-CLIP	23824327
MIRT622330	hsa-miR-203a-3p	HITS-CLIP	23824327
MIRT622329	hsa-miR-578	HITS-CLIP	23824327
MIRT622328	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT610591	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT544275	hsa-miR-4503	HITS-CLIP	23824327
MIRT610590	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT622327	hsa-miR-3675-3p	HITS-CLIP	23824327
MIRT622326	hsa-miR-4528	HITS-CLIP	23824327
MIRT497435	hsa-miR-1470	HITS-CLIP	23824327
MIRT497434	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT622325	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT622324	hsa-miR-4469	HITS-CLIP	23824327
MIRT622323	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT622322	hsa-miR-4287	HITS-CLIP	23824327
MIRT622321	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT622320	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT622319	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT622318	hsa-miR-6083	HITS-CLIP	23824327
MIRT622317	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT614782	hsa-miR-4318	HITS-CLIP	23824327
MIRT610591	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT544275	hsa-miR-4503	HITS-CLIP	23824327
MIRT610590	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT614782	hsa-miR-4318	HITS-CLIP	23824327
MIRT610591	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT544275	hsa-miR-4503	HITS-CLIP	23824327
MIRT610590	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT614782	hsa-miR-4318	HITS-CLIP	23824327
MIRT610591	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT544275	hsa-miR-4503	HITS-CLIP	23824327
MIRT610590	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT610591	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT544275	hsa-miR-4503	HITS-CLIP	23824327
MIRT610590	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT544282	hsa-miR-224-3p	PAR-CLIP	21572407
MIRT544281	hsa-miR-522-3p	PAR-CLIP	21572407
MIRT544280	hsa-miR-4662a-3p	PAR-CLIP	21572407
MIRT544279	hsa-miR-5680	PAR-CLIP	21572407
MIRT544278	hsa-miR-4686	PAR-CLIP	21572407
MIRT544277	hsa-miR-299-5p	PAR-CLIP	21572407
MIRT544276	hsa-miR-4639-5p	PAR-CLIP	21572407
MIRT544275	hsa-miR-4503	PAR-CLIP	21572407
MIRT497437	hsa-miR-3614-5p	PAR-CLIP	22291592
MIRT497436	hsa-miR-6500-3p	PAR-CLIP	22291592
MIRT497435	hsa-miR-1470	PAR-CLIP	22291592
MIRT497434	hsa-miR-4667-3p	PAR-CLIP	22291592
MIRT497433	hsa-miR-520f-5p	PAR-CLIP	22291592
MIRT497432	hsa-miR-4684-5p	PAR-CLIP	22291592
MIRT497431	hsa-miR-4768-5p	PAR-CLIP	22291592
MIRT497430	hsa-miR-6833-3p	PAR-CLIP	22291592
MIRT497429	hsa-miR-6809-3p	PAR-CLIP	22291592
MIRT497428	hsa-miR-514a-3p	PAR-CLIP	22291592
MIRT497427	hsa-miR-514b-3p	PAR-CLIP	22291592
MIRT726640	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT726639	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT614782	hsa-miR-4318	HITS-CLIP	27418678
MIRT614782	hsa-miR-4318	HITS-CLIP	27418678
MIRT544275	hsa-miR-4503	HITS-CLIP	27418678
MIRT544275	hsa-miR-4503	HITS-CLIP	27418678
MIRT610591	hsa-miR-6792-5p	HITS-CLIP	27418678
MIRT610591	hsa-miR-6792-5p	HITS-CLIP	27418678
MIRT610590	hsa-miR-7856-5p	HITS-CLIP	27418678
MIRT610590	hsa-miR-7856-5p	HITS-CLIP	27418678
MIRT614782	hsa-miR-4318	HITS-CLIP	23824327
MIRT610591	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT544275	hsa-miR-4503	HITS-CLIP	23824327
MIRT622327	hsa-miR-3675-3p	HITS-CLIP	23824327
MIRT622326	hsa-miR-4528	HITS-CLIP	23824327
MIRT497435	hsa-miR-1470	HITS-CLIP	23824327
MIRT497434	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT622325	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT622324	hsa-miR-4469	HITS-CLIP	23824327
MIRT622323	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT622322	hsa-miR-4287	HITS-CLIP	23824327
MIRT622321	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT622320	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT622319	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT622318	hsa-miR-6083	HITS-CLIP	23824327
MIRT622317	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT614782	hsa-miR-4318	HITS-CLIP	23824327
MIRT610591	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT544275	hsa-miR-4503	HITS-CLIP	23824327
MIRT610590	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT614782	hsa-miR-4318	HITS-CLIP	23824327
MIRT610591	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT544275	hsa-miR-4503	HITS-CLIP	23824327
MIRT610590	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT614782	hsa-miR-4318	HITS-CLIP	23824327
MIRT610591	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT544275	hsa-miR-4503	HITS-CLIP	23824327
MIRT610590	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT636255	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT636255	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT636254	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT636253	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT636252	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT636251	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT636250	hsa-miR-4252	HITS-CLIP	23824327
MIRT636249	hsa-miR-1254	HITS-CLIP	23824327
MIRT636248	hsa-miR-3116	HITS-CLIP	23824327
MIRT636247	hsa-miR-1227-3p	HITS-CLIP	23824327
MIRT636246	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT636245	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT636244	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT636243	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT636242	hsa-miR-7703	HITS-CLIP	23824327
MIRT614782	hsa-miR-4318	HITS-CLIP	23824327
MIRT610591	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT544275	hsa-miR-4503	HITS-CLIP	23824327
MIRT610590	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT614782	hsa-miR-4318	HITS-CLIP	23824327
MIRT610591	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT544275	hsa-miR-4503	HITS-CLIP	23824327
MIRT610590	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT622336	hsa-miR-5003-3p	HITS-CLIP	23824327
MIRT622335	hsa-miR-6508-5p	HITS-CLIP	23824327
MIRT622334	hsa-miR-8067	HITS-CLIP	23824327
MIRT622333	hsa-miR-4635	HITS-CLIP	23824327
MIRT622332	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT622331	hsa-miR-526b-5p	HITS-CLIP	23824327
MIRT622330	hsa-miR-203a-3p	HITS-CLIP	23824327
MIRT622329	hsa-miR-578	HITS-CLIP	23824327
MIRT622328	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT610591	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT544275	hsa-miR-4503	HITS-CLIP	23824327
MIRT610590	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT622327	hsa-miR-3675-3p	HITS-CLIP	23824327
MIRT622326	hsa-miR-4528	HITS-CLIP	23824327
MIRT497435	hsa-miR-1470	HITS-CLIP	23824327
MIRT497434	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT622325	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT622324	hsa-miR-4469	HITS-CLIP	23824327
MIRT622323	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT622322	hsa-miR-4287	HITS-CLIP	23824327
MIRT622321	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT622320	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT622319	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT622318	hsa-miR-6083	HITS-CLIP	23824327
MIRT622317	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT614782	hsa-miR-4318	HITS-CLIP	23824327
MIRT610591	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT544275	hsa-miR-4503	HITS-CLIP	23824327
MIRT610590	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT614782	hsa-miR-4318	HITS-CLIP	23824327
MIRT610591	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT544275	hsa-miR-4503	HITS-CLIP	23824327
MIRT610590	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT614782	hsa-miR-4318	HITS-CLIP	23824327
MIRT610591	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT544275	hsa-miR-4503	HITS-CLIP	23824327
MIRT610590	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT610591	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT544275	hsa-miR-4503	HITS-CLIP	23824327
MIRT610590	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT544282	hsa-miR-224-3p	PAR-CLIP	21572407
MIRT544281	hsa-miR-522-3p	PAR-CLIP	21572407
MIRT544280	hsa-miR-4662a-3p	PAR-CLIP	21572407
MIRT544279	hsa-miR-5680	PAR-CLIP	21572407
MIRT544278	hsa-miR-4686	PAR-CLIP	21572407
MIRT544277	hsa-miR-299-5p	PAR-CLIP	21572407
MIRT544276	hsa-miR-4639-5p	PAR-CLIP	21572407
MIRT544275	hsa-miR-4503	PAR-CLIP	21572407
MIRT497437	hsa-miR-3614-5p	PAR-CLIP	22291592
MIRT497436	hsa-miR-6500-3p	PAR-CLIP	22291592
MIRT497435	hsa-miR-1470	PAR-CLIP	22291592
MIRT497434	hsa-miR-4667-3p	PAR-CLIP	22291592
MIRT497433	hsa-miR-520f-5p	PAR-CLIP	22291592
MIRT497432	hsa-miR-4684-5p	PAR-CLIP	22291592
MIRT497431	hsa-miR-4768-5p	PAR-CLIP	22291592
MIRT497430	hsa-miR-6833-3p	PAR-CLIP	22291592
MIRT497429	hsa-miR-6809-3p	PAR-CLIP	22291592
MIRT497428	hsa-miR-514a-3p	PAR-CLIP	22291592
MIRT497427	hsa-miR-514b-3p	PAR-CLIP	22291592
MIRT1333628	hsa-miR-103b	CLIP-seq
MIRT1333629	hsa-miR-1202	CLIP-seq
MIRT1333630	hsa-miR-124	CLIP-seq
MIRT1333631	hsa-miR-1246	CLIP-seq
MIRT1333632	hsa-miR-129-3p	CLIP-seq
MIRT1333633	hsa-miR-1299	CLIP-seq
MIRT1333634	hsa-miR-1303	CLIP-seq
MIRT1333635	hsa-miR-141	CLIP-seq
MIRT1333636	hsa-miR-142-5p	CLIP-seq
MIRT1333637	hsa-miR-151-3p	CLIP-seq
MIRT1333638	hsa-miR-186	CLIP-seq
MIRT1333639	hsa-miR-19a	CLIP-seq
MIRT1333640	hsa-miR-19b	CLIP-seq
MIRT1333641	hsa-miR-200a	CLIP-seq
MIRT1333642	hsa-miR-200b	CLIP-seq
MIRT1333643	hsa-miR-200c	CLIP-seq
MIRT1333644	hsa-miR-21	CLIP-seq
MIRT1333645	hsa-miR-219-5p	CLIP-seq
MIRT1333646	hsa-miR-2681	CLIP-seq
MIRT1333647	hsa-miR-3065-5p	CLIP-seq
MIRT1333648	hsa-miR-3074-3p	CLIP-seq
MIRT1333649	hsa-miR-3122	CLIP-seq
MIRT1333650	hsa-miR-3135	CLIP-seq
MIRT1333651	hsa-miR-3143	CLIP-seq
MIRT1333652	hsa-miR-3150b-3p	CLIP-seq
MIRT1333653	hsa-miR-3178	CLIP-seq
MIRT1333654	hsa-miR-3190	CLIP-seq
MIRT1333655	hsa-miR-3194-5p	CLIP-seq
MIRT1333656	hsa-miR-335	CLIP-seq
MIRT1333657	hsa-miR-33a	CLIP-seq
MIRT1333658	hsa-miR-33b	CLIP-seq
MIRT1333659	hsa-miR-340	CLIP-seq
MIRT1333660	hsa-miR-3607-5p	CLIP-seq
MIRT1333661	hsa-miR-3613-3p	CLIP-seq
MIRT1333662	hsa-miR-3613-5p	CLIP-seq
MIRT1333663	hsa-miR-3622b-5p	CLIP-seq
MIRT1333664	hsa-miR-3647-3p	CLIP-seq
MIRT1333665	hsa-miR-365	CLIP-seq
MIRT1333666	hsa-miR-3651	CLIP-seq
MIRT1333667	hsa-miR-3653	CLIP-seq
MIRT1333668	hsa-miR-3658	CLIP-seq
MIRT1333669	hsa-miR-3689a-3p	CLIP-seq
MIRT1333670	hsa-miR-3689c	CLIP-seq
MIRT1333671	hsa-miR-369-3p	CLIP-seq
MIRT1333672	hsa-miR-3714	CLIP-seq
MIRT1333673	hsa-miR-374a	CLIP-seq
MIRT1333674	hsa-miR-374b	CLIP-seq
MIRT1333675	hsa-miR-374c	CLIP-seq
MIRT1333676	hsa-miR-376c	CLIP-seq
MIRT1333677	hsa-miR-378	CLIP-seq
MIRT1333678	hsa-miR-378b	CLIP-seq
MIRT1333679	hsa-miR-378c	CLIP-seq
MIRT1333680	hsa-miR-378d	CLIP-seq
MIRT1333681	hsa-miR-378e	CLIP-seq
MIRT1333682	hsa-miR-378f	CLIP-seq
MIRT1333683	hsa-miR-378h	CLIP-seq
MIRT1333684	hsa-miR-378i	CLIP-seq
MIRT1333685	hsa-miR-383	CLIP-seq
MIRT1333686	hsa-miR-3910	CLIP-seq
MIRT1333687	hsa-miR-3913-5p	CLIP-seq
MIRT1333688	hsa-miR-3929	CLIP-seq
MIRT1333689	hsa-miR-3940-5p	CLIP-seq
MIRT1333690	hsa-miR-3972	CLIP-seq
MIRT1333691	hsa-miR-3973	CLIP-seq
MIRT1333692	hsa-miR-422a	CLIP-seq
MIRT1333693	hsa-miR-429	CLIP-seq
MIRT1333694	hsa-miR-4419b	CLIP-seq
MIRT1333695	hsa-miR-4438	CLIP-seq
MIRT1333696	hsa-miR-4445	CLIP-seq
MIRT1333697	hsa-miR-4455	CLIP-seq
MIRT1333698	hsa-miR-4463	CLIP-seq
MIRT1333699	hsa-miR-4477b	CLIP-seq
MIRT1333700	hsa-miR-4478	CLIP-seq
MIRT1333701	hsa-miR-4486	CLIP-seq
MIRT1333702	hsa-miR-4491	CLIP-seq
MIRT1333703	hsa-miR-4499	CLIP-seq
MIRT1333704	hsa-miR-4505	CLIP-seq
MIRT1333705	hsa-miR-4507	CLIP-seq
MIRT1333706	hsa-miR-4520a-3p	CLIP-seq
MIRT1333707	hsa-miR-455-5p	CLIP-seq
MIRT1333708	hsa-miR-4638-3p	CLIP-seq
MIRT1333709	hsa-miR-4657	CLIP-seq
MIRT1333710	hsa-miR-4687-5p	CLIP-seq
MIRT1333711	hsa-miR-4689	CLIP-seq
MIRT1333712	hsa-miR-4698	CLIP-seq
MIRT1333713	hsa-miR-4728-5p	CLIP-seq
MIRT1333714	hsa-miR-4735-5p	CLIP-seq
MIRT1333715	hsa-miR-4772-5p	CLIP-seq
MIRT1333716	hsa-miR-4775	CLIP-seq
MIRT1333717	hsa-miR-4782-3p	CLIP-seq
MIRT1333718	hsa-miR-4782-5p	CLIP-seq
MIRT1333719	hsa-miR-4784	CLIP-seq
MIRT1333720	hsa-miR-485-5p	CLIP-seq
MIRT1333721	hsa-miR-491-3p	CLIP-seq
MIRT1333722	hsa-miR-495	CLIP-seq
MIRT1333723	hsa-miR-501-3p	CLIP-seq
MIRT1333724	hsa-miR-502-3p	CLIP-seq
MIRT1333725	hsa-miR-505	CLIP-seq
MIRT1333726	hsa-miR-506	CLIP-seq
MIRT1333727	hsa-miR-508-3p	CLIP-seq
MIRT1333728	hsa-miR-5096	CLIP-seq
MIRT1333729	hsa-miR-516b	CLIP-seq
MIRT1333730	hsa-miR-518a-5p	CLIP-seq
MIRT1333731	hsa-miR-527	CLIP-seq
MIRT1333732	hsa-miR-543	CLIP-seq
MIRT1333733	hsa-miR-548aa	CLIP-seq
MIRT1333734	hsa-miR-548ac	CLIP-seq
MIRT1333735	hsa-miR-548d-3p	CLIP-seq
MIRT1333736	hsa-miR-548z	CLIP-seq
MIRT1333737	hsa-miR-562	CLIP-seq
MIRT1333738	hsa-miR-590-3p	CLIP-seq
MIRT1333739	hsa-miR-590-5p	CLIP-seq
MIRT1333740	hsa-miR-609	CLIP-seq
MIRT1333741	hsa-miR-629	CLIP-seq
MIRT1333742	hsa-miR-655	CLIP-seq
MIRT1333743	hsa-miR-656	CLIP-seq
MIRT1920894	hsa-miR-1245b-3p	CLIP-seq
MIRT1920895	hsa-miR-3678-3p	CLIP-seq
MIRT1920896	hsa-miR-4795-3p	CLIP-seq
MIRT1920897	hsa-miR-579	CLIP-seq
MIRT1920894	hsa-miR-1245b-3p	CLIP-seq
MIRT1920895	hsa-miR-3678-3p	CLIP-seq
MIRT1920896	hsa-miR-4795-3p	CLIP-seq
MIRT1920897	hsa-miR-579	CLIP-seq
MIRT1333673	hsa-miR-374a	CLIP-seq
MIRT1333674	hsa-miR-374b	CLIP-seq
MIRT1333629	hsa-miR-1202	CLIP-seq
MIRT2098678	hsa-miR-1238	CLIP-seq
MIRT1333633	hsa-miR-1299	CLIP-seq
MIRT2098679	hsa-miR-1827	CLIP-seq
MIRT2098680	hsa-miR-24	CLIP-seq
MIRT2098681	hsa-miR-27a	CLIP-seq
MIRT2098682	hsa-miR-27b	CLIP-seq
MIRT1333649	hsa-miR-3122	CLIP-seq
MIRT1333651	hsa-miR-3143	CLIP-seq
MIRT1333652	hsa-miR-3150b-3p	CLIP-seq
MIRT1333653	hsa-miR-3178	CLIP-seq
MIRT1333655	hsa-miR-3194-5p	CLIP-seq
MIRT1333662	hsa-miR-3613-5p	CLIP-seq
MIRT1333665	hsa-miR-365	CLIP-seq
MIRT1333666	hsa-miR-3651	CLIP-seq
MIRT2098683	hsa-miR-3664-3p	CLIP-seq
MIRT2098684	hsa-miR-3686	CLIP-seq
MIRT1333669	hsa-miR-3689a-3p	CLIP-seq
MIRT1333670	hsa-miR-3689c	CLIP-seq
MIRT1333671	hsa-miR-369-3p	CLIP-seq
MIRT1333673	hsa-miR-374a	CLIP-seq
MIRT1333674	hsa-miR-374b	CLIP-seq
MIRT1333676	hsa-miR-376c	CLIP-seq
MIRT1333677	hsa-miR-378	CLIP-seq
MIRT1333678	hsa-miR-378b	CLIP-seq
MIRT1333679	hsa-miR-378c	CLIP-seq
MIRT1333680	hsa-miR-378d	CLIP-seq
MIRT1333681	hsa-miR-378e	CLIP-seq
MIRT1333682	hsa-miR-378f	CLIP-seq
MIRT1333683	hsa-miR-378h	CLIP-seq
MIRT1333684	hsa-miR-378i	CLIP-seq
MIRT1333685	hsa-miR-383	CLIP-seq
MIRT1333687	hsa-miR-3913-5p	CLIP-seq
MIRT1333688	hsa-miR-3929	CLIP-seq
MIRT1333690	hsa-miR-3972	CLIP-seq
MIRT2098685	hsa-miR-3977	CLIP-seq
MIRT1333692	hsa-miR-422a	CLIP-seq
MIRT2098686	hsa-miR-4274	CLIP-seq
MIRT2098687	hsa-miR-4277	CLIP-seq
MIRT2098688	hsa-miR-4284	CLIP-seq
MIRT1333694	hsa-miR-4419b	CLIP-seq
MIRT2098689	hsa-miR-4433	CLIP-seq
MIRT1333695	hsa-miR-4438	CLIP-seq
MIRT2098690	hsa-miR-4459	CLIP-seq
MIRT1333700	hsa-miR-4478	CLIP-seq
MIRT1333701	hsa-miR-4486	CLIP-seq
MIRT1333702	hsa-miR-4491	CLIP-seq
MIRT1333704	hsa-miR-4505	CLIP-seq
MIRT2098691	hsa-miR-452	CLIP-seq
MIRT1333706	hsa-miR-4520a-3p	CLIP-seq
MIRT1333708	hsa-miR-4638-3p	CLIP-seq
MIRT2098692	hsa-miR-4649-3p	CLIP-seq
MIRT1333709	hsa-miR-4657	CLIP-seq
MIRT2098693	hsa-miR-4676-3p	CLIP-seq
MIRT1333711	hsa-miR-4689	CLIP-seq
MIRT2098694	hsa-miR-4695-5p	CLIP-seq
MIRT2098695	hsa-miR-4704-3p	CLIP-seq
MIRT1333713	hsa-miR-4728-5p	CLIP-seq
MIRT2098696	hsa-miR-4768-3p	CLIP-seq
MIRT1333715	hsa-miR-4772-5p	CLIP-seq
MIRT2098697	hsa-miR-4779	CLIP-seq
MIRT1333718	hsa-miR-4782-5p	CLIP-seq
MIRT1333719	hsa-miR-4784	CLIP-seq
MIRT1333720	hsa-miR-485-5p	CLIP-seq
MIRT1333722	hsa-miR-495	CLIP-seq
MIRT1333723	hsa-miR-501-3p	CLIP-seq
MIRT1333724	hsa-miR-502-3p	CLIP-seq
MIRT2098698	hsa-miR-510	CLIP-seq
MIRT2098699	hsa-miR-512-5p	CLIP-seq
MIRT2098700	hsa-miR-513a-5p	CLIP-seq
MIRT1333729	hsa-miR-516b	CLIP-seq
MIRT1333730	hsa-miR-518a-5p	CLIP-seq
MIRT1333731	hsa-miR-527	CLIP-seq
MIRT1333732	hsa-miR-543	CLIP-seq
MIRT2098701	hsa-miR-548ae	CLIP-seq
MIRT2098702	hsa-miR-548aj	CLIP-seq
MIRT2098703	hsa-miR-548am	CLIP-seq
MIRT2098704	hsa-miR-548q	CLIP-seq
MIRT2098705	hsa-miR-548x	CLIP-seq
MIRT1333738	hsa-miR-590-3p	CLIP-seq
MIRT2098706	hsa-miR-922	CLIP-seq
MIRT2323398	hsa-miR-101	CLIP-seq
MIRT1333630	hsa-miR-124	CLIP-seq
MIRT2323399	hsa-miR-1264	CLIP-seq
MIRT1333632	hsa-miR-129-3p	CLIP-seq
MIRT2323400	hsa-miR-1343	CLIP-seq
MIRT2323401	hsa-miR-139-5p	CLIP-seq
MIRT2323402	hsa-miR-144	CLIP-seq
MIRT2098679	hsa-miR-1827	CLIP-seq
MIRT1333644	hsa-miR-21	CLIP-seq
MIRT2323403	hsa-miR-298	CLIP-seq
MIRT1333647	hsa-miR-3065-5p	CLIP-seq
MIRT2323404	hsa-miR-3121-5p	CLIP-seq
MIRT2323405	hsa-miR-3125	CLIP-seq
MIRT1333650	hsa-miR-3135	CLIP-seq
MIRT2323406	hsa-miR-3160-3p	CLIP-seq
MIRT2323407	hsa-miR-3180-5p	CLIP-seq
MIRT2323408	hsa-miR-3192	CLIP-seq
MIRT2323409	hsa-miR-320a	CLIP-seq
MIRT2323410	hsa-miR-320b	CLIP-seq
MIRT2323411	hsa-miR-320c	CLIP-seq
MIRT2323412	hsa-miR-320d	CLIP-seq
MIRT2323413	hsa-miR-320e	CLIP-seq
MIRT1333656	hsa-miR-335	CLIP-seq
MIRT2323414	hsa-miR-338-5p	CLIP-seq
MIRT1333661	hsa-miR-3613-3p	CLIP-seq
MIRT1333662	hsa-miR-3613-5p	CLIP-seq
MIRT2323415	hsa-miR-3619-3p	CLIP-seq
MIRT1333664	hsa-miR-3647-3p	CLIP-seq
MIRT2323416	hsa-miR-3649	CLIP-seq
MIRT1333666	hsa-miR-3651	CLIP-seq
MIRT2098683	hsa-miR-3664-3p	CLIP-seq
MIRT1333669	hsa-miR-3689a-3p	CLIP-seq
MIRT1333670	hsa-miR-3689c	CLIP-seq
MIRT1333671	hsa-miR-369-3p	CLIP-seq
MIRT2323417	hsa-miR-3916	CLIP-seq
MIRT1333688	hsa-miR-3929	CLIP-seq
MIRT2323418	hsa-miR-4272	CLIP-seq
MIRT2098686	hsa-miR-4274	CLIP-seq
MIRT2323419	hsa-miR-4276	CLIP-seq
MIRT2323420	hsa-miR-4279	CLIP-seq
MIRT1333694	hsa-miR-4419b	CLIP-seq
MIRT2323421	hsa-miR-4429	CLIP-seq
MIRT2098689	hsa-miR-4433	CLIP-seq
MIRT2323422	hsa-miR-4434	CLIP-seq
MIRT2098690	hsa-miR-4459	CLIP-seq
MIRT1333700	hsa-miR-4478	CLIP-seq
MIRT2323423	hsa-miR-4487	CLIP-seq
MIRT2323424	hsa-miR-4494	CLIP-seq
MIRT2323425	hsa-miR-4516	CLIP-seq
MIRT2323426	hsa-miR-4519	CLIP-seq
MIRT2323427	hsa-miR-4524	CLIP-seq
MIRT2098692	hsa-miR-4649-3p	CLIP-seq
MIRT1333710	hsa-miR-4687-5p	CLIP-seq
MIRT2098694	hsa-miR-4695-5p	CLIP-seq
MIRT1333712	hsa-miR-4698	CLIP-seq
MIRT2098695	hsa-miR-4704-3p	CLIP-seq
MIRT1333713	hsa-miR-4728-5p	CLIP-seq
MIRT2323428	hsa-miR-4729	CLIP-seq
MIRT2098696	hsa-miR-4768-3p	CLIP-seq
MIRT2323429	hsa-miR-4803	CLIP-seq
MIRT1333720	hsa-miR-485-5p	CLIP-seq
MIRT1333723	hsa-miR-501-3p	CLIP-seq
MIRT1333724	hsa-miR-502-3p	CLIP-seq
MIRT1333725	hsa-miR-505	CLIP-seq
MIRT1333726	hsa-miR-506	CLIP-seq
MIRT2098698	hsa-miR-510	CLIP-seq
MIRT2098699	hsa-miR-512-5p	CLIP-seq
MIRT2323430	hsa-miR-516a-3p	CLIP-seq
MIRT2323431	hsa-miR-520a-5p	CLIP-seq
MIRT2323432	hsa-miR-525-5p	CLIP-seq
MIRT2323433	hsa-miR-545	CLIP-seq
MIRT2323434	hsa-miR-558	CLIP-seq
MIRT1333739	hsa-miR-590-5p	CLIP-seq
MIRT2323435	hsa-miR-605	CLIP-seq
MIRT1333741	hsa-miR-629	CLIP-seq
MIRT2323436	hsa-miR-642a	CLIP-seq
MIRT1333743	hsa-miR-656	CLIP-seq
MIRT2323437	hsa-miR-658	CLIP-seq
MIRT2394182	hsa-miR-127-5p	CLIP-seq
MIRT2323407	hsa-miR-3180-5p	CLIP-seq
MIRT2323413	hsa-miR-320e	CLIP-seq
MIRT2323414	hsa-miR-338-5p	CLIP-seq
MIRT2098683	hsa-miR-3664-3p	CLIP-seq
MIRT2098686	hsa-miR-4274	CLIP-seq
MIRT2098689	hsa-miR-4433	CLIP-seq
MIRT2098690	hsa-miR-4459	CLIP-seq
MIRT2323426	hsa-miR-4519	CLIP-seq
MIRT2323427	hsa-miR-4524	CLIP-seq
MIRT2098696	hsa-miR-4768-3p	CLIP-seq
MIRT1333723	hsa-miR-501-3p	CLIP-seq
MIRT1333724	hsa-miR-502-3p	CLIP-seq
MIRT2098698	hsa-miR-510	CLIP-seq
MIRT2098699	hsa-miR-512-5p	CLIP-seq
MIRT1333661	hsa-miR-3613-3p	CLIP-seq
MIRT1333734	hsa-miR-548ac	CLIP-seq
MIRT1333735	hsa-miR-548d-3p	CLIP-seq
MIRT1333736	hsa-miR-548z	CLIP-seq
MIRT1333629	hsa-miR-1202	CLIP-seq
MIRT2619244	hsa-miR-1207-3p	CLIP-seq
MIRT2619245	hsa-miR-1226	CLIP-seq
MIRT2619246	hsa-miR-1265	CLIP-seq
MIRT2619247	hsa-miR-1289	CLIP-seq
MIRT1333632	hsa-miR-129-3p	CLIP-seq
MIRT1333634	hsa-miR-1303	CLIP-seq
MIRT2619248	hsa-miR-1304	CLIP-seq
MIRT2619249	hsa-miR-18a	CLIP-seq
MIRT2619250	hsa-miR-18b	CLIP-seq
MIRT1333645	hsa-miR-219-5p	CLIP-seq
MIRT1333649	hsa-miR-3122	CLIP-seq
MIRT1333652	hsa-miR-3150b-3p	CLIP-seq
MIRT2619251	hsa-miR-3156-3p	CLIP-seq
MIRT1333655	hsa-miR-3194-5p	CLIP-seq
MIRT2619252	hsa-miR-331-5p	CLIP-seq
MIRT2619253	hsa-miR-346	CLIP-seq
MIRT2619254	hsa-miR-34c-3p	CLIP-seq
MIRT1333661	hsa-miR-3613-3p	CLIP-seq
MIRT2619255	hsa-miR-361-5p	CLIP-seq
MIRT2619256	hsa-miR-3646	CLIP-seq
MIRT1333665	hsa-miR-365	CLIP-seq
MIRT1333666	hsa-miR-3651	CLIP-seq
MIRT2619257	hsa-miR-3652	CLIP-seq
MIRT2619258	hsa-miR-3662	CLIP-seq
MIRT1333669	hsa-miR-3689a-3p	CLIP-seq
MIRT1333670	hsa-miR-3689c	CLIP-seq
MIRT2619259	hsa-miR-371-5p	CLIP-seq
MIRT2619260	hsa-miR-371b-5p	CLIP-seq
MIRT2619261	hsa-miR-380	CLIP-seq
MIRT1333687	hsa-miR-3913-5p	CLIP-seq
MIRT2619262	hsa-miR-3924	CLIP-seq
MIRT1333688	hsa-miR-3929	CLIP-seq
MIRT1333689	hsa-miR-3940-5p	CLIP-seq
MIRT1333690	hsa-miR-3972	CLIP-seq
MIRT2619263	hsa-miR-4288	CLIP-seq
MIRT2619264	hsa-miR-4297	CLIP-seq
MIRT2619265	hsa-miR-4301	CLIP-seq
MIRT2619266	hsa-miR-4328	CLIP-seq
MIRT1333694	hsa-miR-4419b	CLIP-seq
MIRT2619267	hsa-miR-4430	CLIP-seq
MIRT2098689	hsa-miR-4433	CLIP-seq
MIRT1333696	hsa-miR-4445	CLIP-seq
MIRT2619268	hsa-miR-4446-3p	CLIP-seq
MIRT1333700	hsa-miR-4478	CLIP-seq
MIRT2619269	hsa-miR-4495	CLIP-seq
MIRT1333705	hsa-miR-4507	CLIP-seq
MIRT2619270	hsa-miR-4521	CLIP-seq
MIRT1333708	hsa-miR-4638-3p	CLIP-seq
MIRT2619271	hsa-miR-4640-3p	CLIP-seq
MIRT2619272	hsa-miR-4656	CLIP-seq
MIRT2619273	hsa-miR-4668-3p	CLIP-seq
MIRT1333710	hsa-miR-4687-5p	CLIP-seq
MIRT1333711	hsa-miR-4689	CLIP-seq
MIRT1333712	hsa-miR-4698	CLIP-seq
MIRT2619274	hsa-miR-4703-3p	CLIP-seq
MIRT2619275	hsa-miR-4715-3p	CLIP-seq
MIRT2619276	hsa-miR-4721	CLIP-seq
MIRT2619277	hsa-miR-4722-3p	CLIP-seq
MIRT1333713	hsa-miR-4728-5p	CLIP-seq
MIRT2619278	hsa-miR-4735-3p	CLIP-seq
MIRT2098697	hsa-miR-4779	CLIP-seq
MIRT1333717	hsa-miR-4782-3p	CLIP-seq
MIRT1333719	hsa-miR-4784	CLIP-seq
MIRT2619279	hsa-miR-4786-5p	CLIP-seq
MIRT2323429	hsa-miR-4803	CLIP-seq
MIRT1333720	hsa-miR-485-5p	CLIP-seq
MIRT2619280	hsa-miR-494	CLIP-seq
MIRT2619281	hsa-miR-502-5p	CLIP-seq
MIRT1333727	hsa-miR-508-3p	CLIP-seq
MIRT2619282	hsa-miR-548a-5p	CLIP-seq
MIRT2619283	hsa-miR-548ab	CLIP-seq
MIRT2619284	hsa-miR-548ak	CLIP-seq
MIRT2619285	hsa-miR-548b-5p	CLIP-seq
MIRT2619286	hsa-miR-548c-3p	CLIP-seq
MIRT2619287	hsa-miR-548c-5p	CLIP-seq
MIRT2619288	hsa-miR-548d-5p	CLIP-seq
MIRT2619289	hsa-miR-548h	CLIP-seq
MIRT2619290	hsa-miR-548i	CLIP-seq
MIRT2619291	hsa-miR-548j	CLIP-seq
MIRT2619292	hsa-miR-548k	CLIP-seq
MIRT2619293	hsa-miR-548l	CLIP-seq
MIRT2619294	hsa-miR-548w	CLIP-seq
MIRT2619295	hsa-miR-548y	CLIP-seq
MIRT2619296	hsa-miR-559	CLIP-seq
MIRT2619297	hsa-miR-570	CLIP-seq
MIRT2323435	hsa-miR-605	CLIP-seq
MIRT1333741	hsa-miR-629	CLIP-seq
MIRT2619298	hsa-miR-632	CLIP-seq
MIRT2619299	hsa-miR-665	CLIP-seq
MIRT2619300	hsa-miR-767-3p	CLIP-seq
MIRT1333629	hsa-miR-1202	CLIP-seq
MIRT2690337	hsa-miR-1231	CLIP-seq
MIRT2619246	hsa-miR-1265	CLIP-seq
MIRT1333632	hsa-miR-129-3p	CLIP-seq
MIRT1333634	hsa-miR-1303	CLIP-seq
MIRT2619248	hsa-miR-1304	CLIP-seq
MIRT1333645	hsa-miR-219-5p	CLIP-seq
MIRT1333649	hsa-miR-3122	CLIP-seq
MIRT1333652	hsa-miR-3150b-3p	CLIP-seq
MIRT2619251	hsa-miR-3156-3p	CLIP-seq
MIRT1333655	hsa-miR-3194-5p	CLIP-seq
MIRT2619253	hsa-miR-346	CLIP-seq
MIRT2619254	hsa-miR-34c-3p	CLIP-seq
MIRT2619255	hsa-miR-361-5p	CLIP-seq
MIRT1333665	hsa-miR-365	CLIP-seq
MIRT1333666	hsa-miR-3651	CLIP-seq
MIRT2619257	hsa-miR-3652	CLIP-seq
MIRT2690338	hsa-miR-3655	CLIP-seq
MIRT1333669	hsa-miR-3689a-3p	CLIP-seq
MIRT1333670	hsa-miR-3689c	CLIP-seq
MIRT1333687	hsa-miR-3913-5p	CLIP-seq
MIRT1333688	hsa-miR-3929	CLIP-seq
MIRT1333689	hsa-miR-3940-5p	CLIP-seq
MIRT1333690	hsa-miR-3972	CLIP-seq
MIRT2619263	hsa-miR-4288	CLIP-seq
MIRT2619265	hsa-miR-4301	CLIP-seq
MIRT2690339	hsa-miR-431	CLIP-seq
MIRT2619266	hsa-miR-4328	CLIP-seq
MIRT1333694	hsa-miR-4419b	CLIP-seq
MIRT2619267	hsa-miR-4430	CLIP-seq
MIRT2098689	hsa-miR-4433	CLIP-seq
MIRT1333696	hsa-miR-4445	CLIP-seq
MIRT2619268	hsa-miR-4446-3p	CLIP-seq
MIRT1333700	hsa-miR-4478	CLIP-seq
MIRT1333705	hsa-miR-4507	CLIP-seq
MIRT2619270	hsa-miR-4521	CLIP-seq
MIRT2619272	hsa-miR-4656	CLIP-seq
MIRT2619273	hsa-miR-4668-3p	CLIP-seq
MIRT1333710	hsa-miR-4687-5p	CLIP-seq
MIRT1333711	hsa-miR-4689	CLIP-seq
MIRT2619274	hsa-miR-4703-3p	CLIP-seq
MIRT2619276	hsa-miR-4721	CLIP-seq
MIRT1333713	hsa-miR-4728-5p	CLIP-seq
MIRT2098697	hsa-miR-4779	CLIP-seq
MIRT1333717	hsa-miR-4782-3p	CLIP-seq
MIRT1333719	hsa-miR-4784	CLIP-seq
MIRT2619279	hsa-miR-4786-5p	CLIP-seq
MIRT2323429	hsa-miR-4803	CLIP-seq
MIRT1333720	hsa-miR-485-5p	CLIP-seq
MIRT2619280	hsa-miR-494	CLIP-seq
MIRT2619281	hsa-miR-502-5p	CLIP-seq
MIRT1333727	hsa-miR-508-3p	CLIP-seq
MIRT2619282	hsa-miR-548a-5p	CLIP-seq
MIRT2619283	hsa-miR-548ab	CLIP-seq
MIRT2619284	hsa-miR-548ak	CLIP-seq
MIRT2619285	hsa-miR-548b-5p	CLIP-seq
MIRT2619286	hsa-miR-548c-3p	CLIP-seq
MIRT2619287	hsa-miR-548c-5p	CLIP-seq
MIRT2619288	hsa-miR-548d-5p	CLIP-seq
MIRT2619289	hsa-miR-548h	CLIP-seq
MIRT2619290	hsa-miR-548i	CLIP-seq
MIRT2619291	hsa-miR-548j	CLIP-seq
MIRT2619292	hsa-miR-548k	CLIP-seq
MIRT2619293	hsa-miR-548l	CLIP-seq
MIRT2619294	hsa-miR-548w	CLIP-seq
MIRT2619295	hsa-miR-548y	CLIP-seq
MIRT2619296	hsa-miR-559	CLIP-seq
MIRT2619297	hsa-miR-570	CLIP-seq
MIRT2323435	hsa-miR-605	CLIP-seq
MIRT1333741	hsa-miR-629	CLIP-seq
MIRT2619298	hsa-miR-632	CLIP-seq
MIRT2619299	hsa-miR-665	CLIP-seq
MIRT2619300	hsa-miR-767-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001889	Process	Liver development	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	21251912, 26871637
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	TAS	10799540
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006612	Process	Protein targeting to membrane	TAS	10799540
GO:0006614	Process	SRP-dependent cotranslational protein targeting to membrane	IBA
GO:0006614	Process	SRP-dependent cotranslational protein targeting to membrane	IEA
GO:0006614	Process	SRP-dependent cotranslational protein targeting to membrane	IEA
GO:0006614	Process	SRP-dependent cotranslational protein targeting to membrane	IMP	22375059
GO:0006620	Process	Post-translational protein targeting to endoplasmic reticulum membrane	IBA
GO:0006620	Process	Post-translational protein targeting to endoplasmic reticulum membrane	IEA
GO:0006620	Process	Post-translational protein targeting to endoplasmic reticulum membrane	IEA
GO:0006620	Process	Post-translational protein targeting to endoplasmic reticulum membrane	IMP	22375059
GO:0008320	Function	Protein transmembrane transporter activity	IBA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IDA	22375059
GO:0016020	Component	Membrane	IEA
GO:0031204	Process	Post-translational protein targeting to membrane, translocation	IMP	29719251
GO:0031207	Component	Sec62/Sec63 complex	IBA
GO:0038023	Function	Signaling receptor activity	TAS	10799540
GO:0071941	Process	Nitrogen cycle metabolic process	IEA

Other IDs

• MIM: 608648
• HGNC: 21082
• e!Ensembl: ENSG00000025796

Protein

• UniProt ID: Q9UGP8
• Protein name: Translocation protein SEC63 homolog (DnaJ homolog subfamily C member 23)
• Protein function: Mediates cotranslational and post-translational transport of certain precursor polypeptides across endoplasmic reticulum (ER) (PubMed:22375059, PubMed:29719251). Proposed to play an auxiliary role in recognition of precursors with short and apol
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00226	DnaJ	104 → 162	DnaJ domain	Domain
  PF02889	Sec63	611 → 713	Sec63 Brl domain	Family
  PF02889	Sec63	222 → 500	Sec63 Brl domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed, with high levels in the liver. {ECO:0000269|PubMed:15133510}.
• Sequence:

  MAGQQFQYDDSGNTFFYFLTSFVGLIVIPATYYLWPRDQNAEQIRLKNIRKVYGRCMWYR
  LRLLKPQPNIIPTVKKIVLLAGWALFLFLAYKVSKTDREYQEYNPYEVLNLDPGATVAEI
  KKQYRLLSLKYHPDKGGDEVMFMRIAKAYAALTDEESRKNWEEFGNPDGPQATSFGIALP
  AWIVDQKNSILVLLVYGLAFMVILPVVVGSWWYRSIRYSGDQILIRTTQIYTYFVYKTRN
  MDMKRLIMVLAGASEFDPQYNKDATSRPTDNILIPQLIREIGSINLKKNEPPLTCPYSLK
  ARVLLLSHLARMKIPETLEEDQQFMLKKCPALLQEMVNVICQLIVMARNREEREFRAPTL
  ASLENCMKLSQMAVQGLQQFKSPLLQLPHIEEDNLRRVSNHKKYKIKTIQDLVSLKESDR
  HTLLHFLEDEKYEEVMAVLGSFPYVTMDIKSQVLDDEDSNNITVGSLVTVLVKLTRQTMA
  EVFEKEQSICAAEEQPAEDGQGETNKNRTKGGWQQKSKGPKKTAKSKKKKPLKKKPTPVL
  LPQSKQQKQKQANGVVGNEAAVKEDEEEVSDKGSDSEEEETNRDSQSEKDDGSDRDSDRE
  QDEKQNKDDEAEWQELQQSIQRKERALLETKSKITHPVYSLYFPEEKQEWWWLYIADRKE
  QTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRSDSYMGLDQIKPLKLEVHEAK
  PVPENHPQWDTAIEGDEDQEDSEGFEDSFEEEEEEEEDDD

• Sequence length: 760

Pathways

KEGG Pathway

Protein export

Protein processing in endoplasmic reticulum

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Autosomal dominant polycystic liver disease	Pathogenic; Likely pathogenic	rs1787750092, rs2114458613, rs1011931149, rs2114454119, rs2114453997, rs768615942, rs779331877, rs2114434218, rs2114476431, rs2114406531, rs2114476499, rs2114476485, rs1403483213, rs1787002281, rs749842172, rs2114426916, rs1787041288, rs2114447040, rs2114461992, rs2114406508, rs768568123, rs2114403750, rs2114487759, rs755795110	RCV005361587 RCV001844876 RCV001844886 RCV001844892 RCV001844905 RCV001844916 RCV001844928 RCV001844934 RCV001844945 RCV001844949 RCV001844951 RCV001844952 RCV001844953 RCV001844954 RCV001844955 RCV001844957 RCV001844958 RCV001844959 RCV001844960 RCV001844961 RCV001844962 RCV001844963 RCV001844964 RCV001844965	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Biliary tract abnormality	Likely pathogenic; Pathogenic	rs768568123	RCV005622119	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Polycystic liver disease 1	Likely pathogenic; Pathogenic	rs869312977, rs869312978	RCV000210666 RCV000210741	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Polycystic liver disease 2	Pathogenic; Likely pathogenic	rs2114446923, rs768615942, rs1403483213, rs768568123, rs2114403750, rs755795110, rs773300876, rs1787039042, rs119103233, rs886041027, rs886041028, rs2482059146, rs752868449, rs1323035335, rs869312977, rs2482042289, rs753182877, rs2482054151, rs1554236269, rs1787041288	RCV001353245 RCV002477879 RCV003992538 RCV002471134 RCV002488454 RCV002506715 RCV001783724 RCV002497853 RCV000002251 RCV000002252 RCV000002253 RCV002471763 RCV002500471 RCV005034440 RCV005031784 RCV003319955 RCV003319956 RCV004018021 RCV000625615 RCV001280819	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
SEC63-related disorder	Likely pathogenic; Pathogenic	rs1403483213, rs2114403750, rs2481999708	RCV003394193 RCV003405746 RCV003983385	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (25)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Autosomal dominant medullary cystic kidney disease with or without hyperuricemia	Conflicting classifications of pathogenicity	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL DOMINANT TUBULOINTERSTITIAL KIDNEY DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Uncertain significance; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	29472232	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Uncertain significance; Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	21685914	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	21685914	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC LIVER DISEASE 2 WITH OR WITHOUT KIDNEY CYSTS	—	Disgenet, HPO Disgenet, HPO	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign; Conflicting classifications of pathogenicity	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (24)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37122003	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	23537056		★☆☆☆☆ Found in Text Mining only
Isolated polycystic liver disease	Polycystic liver disease	BEFREE	20408955, 24506938, 26365003		★☆☆☆☆ Found in Text Mining only
Isolated polycystic liver disease	Polycystic liver disease	Orphanet			★☆☆☆☆ Found in Text Mining only
Kidney Diseases Cystic	Kidney disease	Pubtator	36573973	Associate	★☆☆☆☆ Found in Text Mining only
Liver cyst	Liver Cyst	BEFREE	16835903, 22864019, 23668934, 30652979		★☆☆☆☆ Found in Text Mining only
Liver cyst	Liver Cyst	HPO_DG			★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	23209713	Associate	★☆☆☆☆ Found in Text Mining only
Lynch Syndrome	Lynch Syndrome	BEFREE	23537056		★☆☆☆☆ Found in Text Mining only
Multiple renal cysts	Multiple renal cysts	HPO_DG			★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	30135240	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	CTD_human_DG	21685914		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	24506938, 30652979		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	24506938, 30099615		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Type 1 Autosomal Dominant Disease	Polycystic kidney disease	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Polycystic liver disease	Polycystic liver disease	BEFREE	15133510, 16338757, 16835903, 17071140, 18224332, 19801576, 20408955, 21251912, 22864019, 23209713, 24506938, 26365003		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic liver disease	Polycystic liver disease	Pubtator	18587325, 23326178, 24706814, 27259053, 27552964, 30135240, 38101549	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic liver disease	Polycystic liver disease	CTD_human_DG	21685914		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic liver disease	Polycystic liver disease	ORPHANET_DG	24886261		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic liver disease	Polycystic liver disease	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC LIVER DISEASE 2 WITH OR WITHOUT KIDNEY CYSTS	Polycystic liver disease	GENOMICS_ENGLAND_DG	15133510		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC LIVER DISEASE 2 WITH OR WITHOUT KIDNEY CYSTS	Polycystic liver disease	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	19878916	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

PRKCSH 2 shared diseasesPolycystic kidney disease, Polycystic liver disease 1 shared pathwayProtein processing in endoplasmic reticulum 8 shared evidence sourcesDisgenet (Polycystic kidney disease), ClinVar (Polycystic liver disease), CTD (Polycystic kidney disease), Disgenet (Polycystic liver disease), CTD (Polycystic liver disease), ClinGen (Polycystic liver disease), GenCC (Polycystic liver disease), HPO (Polycystic liver disease) Related via 2 shared diseases including Polycystic kidney disease, Polycystic liver disease — evidence mostly Disgenet. DKK3 2 shared diseasesPolycystic kidney disease, Polycystic liver disease 2 shared evidence sourcesDisgenet (Polycystic kidney disease), Disgenet (Polycystic liver disease) Related via 2 shared diseases including Polycystic kidney disease, Polycystic liver disease — evidence mostly Disgenet. ONECUT2 2 shared diseasesPolycystic kidney disease, Polycystic liver disease 2 shared evidence sourcesDisgenet (Polycystic kidney disease), Disgenet (Polycystic liver disease) Related via 2 shared diseases including Polycystic kidney disease, Polycystic liver disease — evidence mostly Disgenet. ALG8 2 shared diseasesPolycystic kidney disease, Polycystic liver disease 5 shared evidence sourcesDisgenet (Polycystic kidney disease), ClinVar (Polycystic liver disease), Disgenet (Polycystic liver disease), GenCC (Polycystic liver disease), HPO (Polycystic liver disease) Related via 2 shared diseases including Polycystic kidney disease, Polycystic liver disease — evidence mostly Disgenet. SEC62 2 shared pathwaysProtein export, Protein processing in endoplasmic reticulum Related via 2 shared pathways including Protein export, Protein processing in endoplasmic reticulum.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PRKCSH	2	["Polycystic kidney disease","Polycystic liver disease"]	1	["Protein processing in endoplasmic reticulum"]	8	["Disgenet (Polycystic kidney disease)","ClinVar (Polycystic liver disease)","CTD (Polycystic kidney disease)","Disgenet (Polycystic liver disease)","CTD (Polycystic liver disease)","ClinGen (Polycystic liver disease)","GenCC (Polycystic liver disease)","HPO (Polycystic liver disease)"]
DKK3	2	["Polycystic kidney disease","Polycystic liver disease"]	0	[]	2	["Disgenet (Polycystic kidney disease)","Disgenet (Polycystic liver disease)"]
ONECUT2	2	["Polycystic kidney disease","Polycystic liver disease"]	0	[]	2	["Disgenet (Polycystic kidney disease)","Disgenet (Polycystic liver disease)"]
ALG8	2	["Polycystic kidney disease","Polycystic liver disease"]	0	[]	5	["Disgenet (Polycystic kidney disease)","ClinVar (Polycystic liver disease)","Disgenet (Polycystic liver disease)","GenCC (Polycystic liver disease)","HPO (Polycystic liver disease)"]
SEC62	0	[]	2	["Protein export","Protein processing in endoplasmic reticulum"]	0	[]

Diseases Linked via Similar Genes

Liver disease Linked via 1 of 5 related genesPRKCSH polycystic liver disease 1 Linked via 1 of 5 related genesPRKCSH Breast cancer Linked via 1 of 5 related genesDKK3 Schizophrenia Linked via 1 of 5 related genesDKK3 Migraine Linked via 1 of 5 related genesONECUT2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Liver disease	1	["PRKCSH"]
polycystic liver disease 1	1	["PRKCSH"]
Breast cancer	1	["DKK3"]
Schizophrenia	1	["DKK3"]
Migraine	1	["ONECUT2"]