SAP30 (Sin3A associated protein 30)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 8819
Gene name Sin3A associated protein 30
Gene symbol SAP30
Synonyms (NCBI Gene)
-
Chromosome 4
Chromosome location 4q34.1
Summary Histone acetylation plays a key role in the regulation of eukaryotic gene expression. Histone acetylation and deacetylation are catalyzed by multisubunit complexes. The protein encoded by this gene is a component of the histone deacetylase complex, which
miRNA miRNA information provided by mirtarbase database.
17 Show/Hide all (17)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT024621 hsa-miR-215-5p Microarray 19074876
MIRT026771 hsa-miR-192-5p Microarray 19074876
MIRT049800 hsa-miR-92a-3p CLASH 23622248
MIRT620608 hsa-miR-382-5p HITS-CLIP 23824327
MIRT620607 hsa-miR-4773 HITS-CLIP 23824327
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Download as csvDownload as pdf
Transcription factor Regulation Reference
YY1 Unknown 12788099
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22 Show/Hide all (22)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000118 Component Histone deacetylase complex IBA
GO:0000118 Component Histone deacetylase complex IDA 9651585
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 9651585
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II NAS 9651585, 22865885
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
603378 10532 ENSG00000164105
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75446
Protein name Histone deacetylase complex subunit SAP30 (30 kDa Sin3-associated polypeptide) (Sin3 corepressor complex subunit SAP30) (Sin3-associated polypeptide p30)
Protein function Involved in the functional recruitment of the Sin3-histone deacetylase complex (HDAC) to a specific subset of N-CoR corepressor complexes. Capable of transcription repression by N-CoR. Active in deacetylating core histone octamers (when in a com
PDB 2KDP
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13866 zf-SAP30 62 → 133 SAP30 zinc-finger Domain
PF13867 SAP30_Sin3_bdg 153 → 205 Sin3 binding region of histone deacetylase complex subunit SAP30 Family
Tissue specificity TISSUE SPECIFICITY: Expressed in all tissues tested with highest levels in pancreas, ovary, PBL, spleen and thymus; lowest levels in brain, placenta, lung and kidney. {ECO:0000269|PubMed:9702189}.
Sequence 
MNGFTPDEMSRGGDAAAAVAAVVAAAAAAASAGNGTGAGTGAEVPGAGAVSAAGPPGAAG
PGPGQLCCLREDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLIQ
SVRNRRKRKGSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVE
IVGCHFRSIPVNEKDTLTYFIYSVKNDKNKSDLKVDSGVH
Sequence length 220
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Epstein-Barr virus infection HDACs deacetylate histones
Sort by:
SAP30L 2 shared pathwaysEpstein-Barr virus infection, HDACs deacetylate histones Related via 2 shared pathways including Epstein-Barr virus infection, HDACs deacetylate histones. NCOR2 2 shared pathwaysEpstein-Barr virus infection, HDACs deacetylate histones Related via 2 shared pathways including Epstein-Barr virus infection, HDACs deacetylate histones. HDAC2 2 shared pathwaysEpstein-Barr virus infection, HDACs deacetylate histones Related via 2 shared pathways including Epstein-Barr virus infection, HDACs deacetylate histones. HDAC1 2 shared pathwaysEpstein-Barr virus infection, HDACs deacetylate histones Related via 2 shared pathways including Epstein-Barr virus infection, HDACs deacetylate histones.
Schizophrenia Linked via 3 of 4 related genesNCOR2, HDAC2, HDAC1 Alzheimer disease Linked via 2 of 4 related genesSAP30L, NCOR2 Diabetes mellitus type 2 Linked via 2 of 4 related genesNCOR2, HDAC2 Squamous cell carcinoma Linked via 2 of 4 related genesHDAC2, HDAC1 Endometriosis Linked via 2 of 4 related genesHDAC2, HDAC1