RPS4Y1 (ribosomal protein S4 Y-linked 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 6192
• Gene name: Ribosomal protein S4 Y-linked 1
• Gene symbol: RPS4Y1
• Synonyms (NCBI Gene): RPS4Y, S4
• Chromosome: Y
• Chromosome location: Yp11.2
• Summary: Cytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes ribosom

miRNA Show/Hide all (18)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051760	hsa-let-7c-5p	CLASH	23622248
MIRT049875	hsa-miR-31-5p	CLASH	23622248
MIRT532191	hsa-miR-3617-5p	PAR-CLIP	22012620
MIRT532189	hsa-miR-641	PAR-CLIP	22012620
MIRT532187	hsa-miR-7161-3p	PAR-CLIP	22012620
MIRT532188	hsa-miR-8063	PAR-CLIP	22012620
MIRT532186	hsa-miR-208a-3p	PAR-CLIP	22012620
MIRT532185	hsa-miR-208b-3p	PAR-CLIP	22012620
MIRT532184	hsa-miR-499a-5p	PAR-CLIP	22012620
MIRT230215	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT230216	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT532191	hsa-miR-3617-5p	PAR-CLIP	22012620
MIRT532189	hsa-miR-641	PAR-CLIP	22012620
MIRT532187	hsa-miR-7161-3p	PAR-CLIP	22012620
MIRT532188	hsa-miR-8063	PAR-CLIP	22012620
MIRT532186	hsa-miR-208a-3p	PAR-CLIP	22012620
MIRT532185	hsa-miR-208b-3p	PAR-CLIP	22012620
MIRT532184	hsa-miR-499a-5p	PAR-CLIP	22012620

Gene ontology (GO) Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	TAS	2124517
GO:0003735	Function	Structural constituent of ribosome	IBA
GO:0003735	Function	Structural constituent of ribosome	IEA
GO:0003735	Function	Structural constituent of ribosome	IMP	8358435
GO:0003735	Function	Structural constituent of ribosome	TAS	2124517
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005840	Component	Ribosome	IDA	8139551
GO:0005840	Component	Ribosome	IEA
GO:0006412	Process	Translation	IBA
GO:0006412	Process	Translation	IEA
GO:0006412	Process	Translation	IMP	8358435
GO:0006412	Process	Translation	TAS	2124517
GO:0016020	Component	Membrane	HDA	19946888
GO:0019843	Function	RRNA binding	IEA
GO:0022627	Component	Cytosolic small ribosomal subunit	IBA
GO:0022627	Component	Cytosolic small ribosomal subunit	NAS	8358435
GO:0022627	Component	Cytosolic small ribosomal subunit	TAS	2124517
GO:1990904	Component	Ribonucleoprotein complex	IEA

Other IDs

• MIM: 470000
• HGNC: 10425
• e!Ensembl: ENSG00000129824

Protein

• UniProt ID: P22090
• Protein name: Small ribosomal subunit protein eS4, Y isoform 1 (40S ribosomal protein S4)
• PDB: 5AJ0 , 5FLX , 6OLG , 6OLZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00467	KOW	177 → 211	KOW motif	Family
  PF00900	Ribosomal_S4e	95 → 169	Ribosomal family S4e	Family
  PF08071	RS4NT	3 → 39	RS4NT (NUC023) domain	Domain
  PF16121	40S_S4_C	212 → 259	40S ribosomal protein S4 C-terminus	Family

• Sequence:

  MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDE
  VKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAK
  YKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNL
  CMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPR
  GKGIRLTVAEERDKRLATKQSSG

• Sequence length: 263

Pathways

KEGG Pathway	Reactome Pathway
Ribosome	L13a-mediated translational silencing of Ceruloplasmin expression
Coronavirus disease - COVID-19	SRP-dependent cotranslational protein targeting to membrane
	Viral mRNA Translation
	Major pathway of rRNA processing in the nucleolus and cytosol
	Translation initiation complex formation
	Formation of a pool of free 40S subunits
	Formation of the ternary complex, and subsequently, the 43S complex
	Ribosomal scanning and start codon recognition
	GTP hydrolysis and joining of the 60S ribosomal subunit
	Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)
	Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)

Related Genes

Sort by: Blended Diseases Pathways Evidence source

RPS4Y2 13 shared pathwaysRibosome, Coronavirus disease - COVID-19, Major pathway of rRNA processing in the nucleolus and cytosol, L13a-mediated translational silencing of Ceruloplasmin expression, Translation initiation complex formation, Formation of a pool of free 40S subunits, Formation of the ternary complex, and subsequently, the 43S complex, Ribosomal scanning and start codon recognition, GTP hydrolysis and joining of the 60S ribosomal subunit, Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC), SRP-dependent cotranslational protein targeting to membrane, Viral mRNA Translation +1 more Related via 13 shared pathways including Ribosome, Coronavirus disease - COVID-19. RPSA 13 shared pathwaysRibosome, Coronavirus disease - COVID-19, Major pathway of rRNA processing in the nucleolus and cytosol, L13a-mediated translational silencing of Ceruloplasmin expression, Translation initiation complex formation, Formation of a pool of free 40S subunits, Formation of the ternary complex, and subsequently, the 43S complex, Ribosomal scanning and start codon recognition, GTP hydrolysis and joining of the 60S ribosomal subunit, Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC), SRP-dependent cotranslational protein targeting to membrane, Viral mRNA Translation +1 more Related via 13 shared pathways including Ribosome, Coronavirus disease - COVID-19. RPS27L 13 shared pathwaysRibosome, Coronavirus disease - COVID-19, Major pathway of rRNA processing in the nucleolus and cytosol, L13a-mediated translational silencing of Ceruloplasmin expression, Translation initiation complex formation, Formation of a pool of free 40S subunits, Formation of the ternary complex, and subsequently, the 43S complex, Ribosomal scanning and start codon recognition, GTP hydrolysis and joining of the 60S ribosomal subunit, Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC), SRP-dependent cotranslational protein targeting to membrane, Viral mRNA Translation +1 more Related via 13 shared pathways including Ribosome, Coronavirus disease - COVID-19. RPS3A 13 shared pathwaysRibosome, Coronavirus disease - COVID-19, Major pathway of rRNA processing in the nucleolus and cytosol, L13a-mediated translational silencing of Ceruloplasmin expression, Translation initiation complex formation, Formation of a pool of free 40S subunits, Formation of the ternary complex, and subsequently, the 43S complex, Ribosomal scanning and start codon recognition, GTP hydrolysis and joining of the 60S ribosomal subunit, Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC), SRP-dependent cotranslational protein targeting to membrane, Viral mRNA Translation +1 more Related via 13 shared pathways including Ribosome, Coronavirus disease - COVID-19. RPS4X 13 shared pathwaysRibosome, Coronavirus disease - COVID-19, Major pathway of rRNA processing in the nucleolus and cytosol, L13a-mediated translational silencing of Ceruloplasmin expression, Translation initiation complex formation, Formation of a pool of free 40S subunits, Formation of the ternary complex, and subsequently, the 43S complex, Ribosomal scanning and start codon recognition, GTP hydrolysis and joining of the 60S ribosomal subunit, Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC), SRP-dependent cotranslational protein targeting to membrane, Viral mRNA Translation +1 more Related via 13 shared pathways including Ribosome, Coronavirus disease - COVID-19.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
RPS4Y2	0	[]	13	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Translation initiation complex formation","Formation of a pool of free 40S subunits","Formation of the ternary complex, and subsequently, the 43S complex","Ribosomal scanning and start codon recognition","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation"]	0	[]
RPSA	0	[]	13	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Translation initiation complex formation","Formation of a pool of free 40S subunits","Formation of the ternary complex, and subsequently, the 43S complex","Ribosomal scanning and start codon recognition","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation"]	0	[]
RPS27L	0	[]	13	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Translation initiation complex formation","Formation of a pool of free 40S subunits","Formation of the ternary complex, and subsequently, the 43S complex","Ribosomal scanning and start codon recognition","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation"]	0	[]
RPS3A	0	[]	13	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Translation initiation complex formation","Formation of a pool of free 40S subunits","Formation of the ternary complex, and subsequently, the 43S complex","Ribosomal scanning and start codon recognition","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation"]	0	[]
RPS4X	0	[]	13	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Translation initiation complex formation","Formation of a pool of free 40S subunits","Formation of the ternary complex, and subsequently, the 43S complex","Ribosomal scanning and start codon recognition","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation"]	0	[]

Diseases Linked via Similar Genes

Spermatogenic failure, y-linked Linked via 1 of 5 related genesRPS4Y2 Asplenia Linked via 1 of 5 related genesRPSA Congenital asplenia Linked via 1 of 5 related genesRPSA Frontotemporal dementia Linked via 1 of 5 related genesRPSA Schizophrenia Linked via 1 of 5 related genesRPSA

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Spermatogenic failure, y-linked	1	["RPS4Y2"]
Asplenia	1	["RPSA"]
Congenital asplenia	1	["RPSA"]
Frontotemporal dementia	1	["RPSA"]
Schizophrenia	1	["RPSA"]