Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	51065
Gene name	Ribosomal protein S27 like
Gene symbol	RPS27L
Synonyms (NCBI Gene)	-
Chromosome	15
Chromosome location	15q22.2
Summary	This gene encodes a protein sharing 96% amino acid similarity with ribosomal protein S27, which suggests the encoded protein may be a component of the 40S ribosomal subunit. [provided by RefSeq, Jul 2008]

114 Show/Hide all (114)

miRTarBase ID	miRNA	Experiments	Reference
MIRT041935	hsa-miR-484	CLASH	23622248
MIRT1317931	hsa-miR-3144-3p	CLIP-seq
MIRT1317932	hsa-miR-3192	CLIP-seq
MIRT1317933	hsa-miR-3689a-3p	CLIP-seq
MIRT1317934	hsa-miR-3689c	CLIP-seq
MIRT1317935	hsa-miR-380	CLIP-seq
MIRT1317936	hsa-miR-4267	CLIP-seq
MIRT1317937	hsa-miR-4314	CLIP-seq
MIRT1317938	hsa-miR-4537	CLIP-seq
MIRT1317939	hsa-miR-4667-5p	CLIP-seq
MIRT1317940	hsa-miR-4700-5p	CLIP-seq
MIRT1317941	hsa-miR-4718	CLIP-seq
MIRT1317942	hsa-miR-4728-5p	CLIP-seq
MIRT1317943	hsa-miR-4793-3p	CLIP-seq
MIRT1317944	hsa-miR-508-5p	CLIP-seq
MIRT1317945	hsa-miR-520d-5p	CLIP-seq
MIRT1317946	hsa-miR-524-5p	CLIP-seq
MIRT1317947	hsa-miR-548aa	CLIP-seq
MIRT1317948	hsa-miR-637	CLIP-seq
MIRT1317949	hsa-miR-658	CLIP-seq
MIRT1317950	hsa-miR-766	CLIP-seq
MIRT1317951	hsa-miR-875-5p	CLIP-seq
MIRT1317931	hsa-miR-3144-3p	CLIP-seq
MIRT2094466	hsa-miR-323-3p	CLIP-seq
MIRT1317935	hsa-miR-380	CLIP-seq
MIRT1317941	hsa-miR-4718	CLIP-seq
MIRT1317945	hsa-miR-520d-5p	CLIP-seq
MIRT1317946	hsa-miR-524-5p	CLIP-seq
MIRT1317947	hsa-miR-548aa	CLIP-seq
MIRT1317951	hsa-miR-875-5p	CLIP-seq
MIRT1317931	hsa-miR-3144-3p	CLIP-seq
MIRT1317932	hsa-miR-3192	CLIP-seq
MIRT2094466	hsa-miR-323-3p	CLIP-seq
MIRT1317933	hsa-miR-3689a-3p	CLIP-seq
MIRT1317934	hsa-miR-3689c	CLIP-seq
MIRT1317935	hsa-miR-380	CLIP-seq
MIRT1317936	hsa-miR-4267	CLIP-seq
MIRT1317938	hsa-miR-4537	CLIP-seq
MIRT2318978	hsa-miR-4658	CLIP-seq
MIRT1317941	hsa-miR-4718	CLIP-seq
MIRT1317942	hsa-miR-4728-5p	CLIP-seq
MIRT2318979	hsa-miR-4758-5p	CLIP-seq
MIRT2318980	hsa-miR-4765	CLIP-seq
MIRT1317943	hsa-miR-4793-3p	CLIP-seq
MIRT1317944	hsa-miR-508-5p	CLIP-seq
MIRT1317945	hsa-miR-520d-5p	CLIP-seq
MIRT1317946	hsa-miR-524-5p	CLIP-seq
MIRT1317947	hsa-miR-548aa	CLIP-seq
MIRT1317949	hsa-miR-658	CLIP-seq
MIRT1317950	hsa-miR-766	CLIP-seq
MIRT1317951	hsa-miR-875-5p	CLIP-seq
MIRT1317931	hsa-miR-3144-3p	CLIP-seq
MIRT1317935	hsa-miR-380	CLIP-seq
MIRT1317941	hsa-miR-4718	CLIP-seq
MIRT1317945	hsa-miR-520d-5p	CLIP-seq
MIRT1317946	hsa-miR-524-5p	CLIP-seq
MIRT1317947	hsa-miR-548aa	CLIP-seq
MIRT1317951	hsa-miR-875-5p	CLIP-seq
MIRT2614692	hsa-miR-1286	CLIP-seq
MIRT2614693	hsa-miR-2278	CLIP-seq
MIRT2614694	hsa-miR-31	CLIP-seq
MIRT1317931	hsa-miR-3144-3p	CLIP-seq
MIRT2614695	hsa-miR-3160-5p	CLIP-seq
MIRT2614696	hsa-miR-3161	CLIP-seq
MIRT2094466	hsa-miR-323-3p	CLIP-seq
MIRT2614697	hsa-miR-3613-3p	CLIP-seq
MIRT2614698	hsa-miR-3688-3p	CLIP-seq
MIRT1317933	hsa-miR-3689a-3p	CLIP-seq
MIRT1317934	hsa-miR-3689c	CLIP-seq
MIRT2614699	hsa-miR-371-5p	CLIP-seq
MIRT2614700	hsa-miR-371b-5p	CLIP-seq
MIRT1317935	hsa-miR-380	CLIP-seq
MIRT2614701	hsa-miR-4282	CLIP-seq
MIRT2614702	hsa-miR-4652-3p	CLIP-seq
MIRT2614703	hsa-miR-4677-3p	CLIP-seq
MIRT2614704	hsa-miR-4679	CLIP-seq
MIRT1317941	hsa-miR-4718	CLIP-seq
MIRT1317942	hsa-miR-4728-5p	CLIP-seq
MIRT1317945	hsa-miR-520d-5p	CLIP-seq
MIRT1317946	hsa-miR-524-5p	CLIP-seq
MIRT1317947	hsa-miR-548aa	CLIP-seq
MIRT2614705	hsa-miR-873	CLIP-seq
MIRT1317951	hsa-miR-875-5p	CLIP-seq
MIRT2614706	hsa-miR-890	CLIP-seq
MIRT2614692	hsa-miR-1286	CLIP-seq
MIRT2614693	hsa-miR-2278	CLIP-seq
MIRT2614694	hsa-miR-31	CLIP-seq
MIRT2690020	hsa-miR-3129-3p	CLIP-seq
MIRT1317931	hsa-miR-3144-3p	CLIP-seq
MIRT2614695	hsa-miR-3160-5p	CLIP-seq
MIRT2614696	hsa-miR-3161	CLIP-seq
MIRT2094466	hsa-miR-323-3p	CLIP-seq
MIRT2614697	hsa-miR-3613-3p	CLIP-seq
MIRT2690021	hsa-miR-3662	CLIP-seq
MIRT2614698	hsa-miR-3688-3p	CLIP-seq
MIRT1317933	hsa-miR-3689a-3p	CLIP-seq
MIRT1317934	hsa-miR-3689c	CLIP-seq
MIRT2614699	hsa-miR-371-5p	CLIP-seq
MIRT2614700	hsa-miR-371b-5p	CLIP-seq
MIRT1317935	hsa-miR-380	CLIP-seq
MIRT2614701	hsa-miR-4282	CLIP-seq
MIRT2614702	hsa-miR-4652-3p	CLIP-seq
MIRT2614703	hsa-miR-4677-3p	CLIP-seq
MIRT2614704	hsa-miR-4679	CLIP-seq
MIRT1317941	hsa-miR-4718	CLIP-seq
MIRT1317942	hsa-miR-4728-5p	CLIP-seq
MIRT2690022	hsa-miR-513a-3p	CLIP-seq
MIRT1317945	hsa-miR-520d-5p	CLIP-seq
MIRT1317946	hsa-miR-524-5p	CLIP-seq
MIRT1317947	hsa-miR-548aa	CLIP-seq
MIRT2690023	hsa-miR-590-3p	CLIP-seq
MIRT2614705	hsa-miR-873	CLIP-seq
MIRT1317951	hsa-miR-875-5p	CLIP-seq
MIRT2614706	hsa-miR-890	CLIP-seq

18 Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000028	Process	Ribosomal small subunit assembly	IBA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003723	Function	RNA binding	IBA
GO:0003735	Function	Structural constituent of ribosome	IBA
GO:0003735	Function	Structural constituent of ribosome	IEA
GO:0005515	Function	Protein binding	IPI	21170087
GO:0005634	Component	Nucleus	IDA	18056458
GO:0005840	Component	Ribosome	IEA
GO:0006412	Process	Translation	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008494	Function	Translation activator activity	IDA	18056458
GO:0022627	Component	Cytosolic small ribosomal subunit	IBA
GO:0030330	Process	DNA damage response, signal transduction by p53 class mediator	IDA	18056458
GO:0031571	Process	Mitotic G1 DNA damage checkpoint signaling	IMP	18056458
GO:0042771	Process	Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IDA	17057733, 18056458
GO:0045727	Process	Positive regulation of translation	IDA	18056458
GO:0046872	Function	Metal ion binding	IEA
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
612055	18476	ENSG00000185088

Q71UM5

Protein name

Ribosomal protein eS27-like (40S ribosomal protein S27-like) (Small ribosomal subunit protein eS27-like)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01667	Ribosomal_S27e	28 → 82	Ribosomal protein S27	Family

Sequence

MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCS
TVLCQPTGGKARLTEGCSFRRKQH

Sequence length

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Ribosome	L13a-mediated translational silencing of Ceruloplasmin expression
Coronavirus disease - COVID-19	SRP-dependent cotranslational protein targeting to membrane
	Viral mRNA Translation
	Major pathway of rRNA processing in the nucleolus and cytosol
	Translation initiation complex formation
	Formation of a pool of free 40S subunits
	Formation of the ternary complex, and subsequently, the 43S complex
	Ribosomal scanning and start codon recognition
	GTP hydrolysis and joining of the 60S ribosomal subunit
	Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)
	Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DENTAL CARIES	—	GWAS catalog	39192244	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (8)
Breast Carcinoma	Breast Carcinoma	BEFREE	30425236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32444848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23826192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23826192	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	33051438	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30425236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	32255672	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	33711033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
RPS4Y2	[]	13	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Translation initiation complex formation","Formation of a pool of free 40S subunits","Formation of the ternary complex, and subsequently, the 43S complex","Ribosomal scanning and start codon recognition","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation"]	[]
RPSA	[]	13	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Translation initiation complex formation","Formation of a pool of free 40S subunits","Formation of the ternary complex, and subsequently, the 43S complex","Ribosomal scanning and start codon recognition","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation"]	[]
RPS3A	[]	13	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Translation initiation complex formation","Formation of a pool of free 40S subunits","Formation of the ternary complex, and subsequently, the 43S complex","Ribosomal scanning and start codon recognition","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation"]	[]
RPS4X	[]	13	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Translation initiation complex formation","Formation of a pool of free 40S subunits","Formation of the ternary complex, and subsequently, the 43S complex","Ribosomal scanning and start codon recognition","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation"]	[]
RPS4Y1	[]	13	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Translation initiation complex formation","Formation of a pool of free 40S subunits","Formation of the ternary complex, and subsequently, the 43S complex","Ribosomal scanning and start codon recognition","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation"]	[]

RPS27L (ribosomal protein S27 like)

Save This Analysis