RPN1 (ribophorin I)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 6184
• Gene name: Ribophorin I
• Gene symbol: RPN1
• Synonyms (NCBI Gene): OST1, RBPH1
• Chromosome: 3
• Chromosome location: 3q21.3
• Summary: This gene encodes a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-S

miRNA Show/Hide all (201)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020068	hsa-miR-375	Microarray	20215506
MIRT030197	hsa-miR-26b-5p	Microarray	19088304
MIRT048357	hsa-miR-103a-3p	CLASH	23622248
MIRT020068	hsa-miR-375	Luciferase reporter assay, Western blotting, qRT-PCR, Immunoprecipitaion (IP)	37386831
MIRT1317077	hsa-miR-1236	CLIP-seq
MIRT1317078	hsa-miR-151-3p	CLIP-seq
MIRT1317079	hsa-miR-193a-3p	CLIP-seq
MIRT1317080	hsa-miR-193b	CLIP-seq
MIRT1317081	hsa-miR-2861	CLIP-seq
MIRT1317082	hsa-miR-3154	CLIP-seq
MIRT1317083	hsa-miR-3156-3p	CLIP-seq
MIRT1317084	hsa-miR-3176	CLIP-seq
MIRT1317085	hsa-miR-377	CLIP-seq
MIRT1317086	hsa-miR-3918	CLIP-seq
MIRT1317087	hsa-miR-3922-3p	CLIP-seq
MIRT1317088	hsa-miR-3929	CLIP-seq
MIRT1317089	hsa-miR-3945	CLIP-seq
MIRT1317090	hsa-miR-4301	CLIP-seq
MIRT1317091	hsa-miR-4419b	CLIP-seq
MIRT1317092	hsa-miR-4420	CLIP-seq
MIRT1317093	hsa-miR-4478	CLIP-seq
MIRT1317094	hsa-miR-4512	CLIP-seq
MIRT1317095	hsa-miR-4635	CLIP-seq
MIRT1317096	hsa-miR-4753-3p	CLIP-seq
MIRT1317097	hsa-miR-4757-5p	CLIP-seq
MIRT1317098	hsa-miR-4761-3p	CLIP-seq
MIRT1317099	hsa-miR-4768-5p	CLIP-seq
MIRT1317100	hsa-miR-4773	CLIP-seq
MIRT1317101	hsa-miR-502-5p	CLIP-seq
MIRT1317102	hsa-miR-532-3p	CLIP-seq
MIRT1317103	hsa-miR-587	CLIP-seq
MIRT1317088	hsa-miR-3929	CLIP-seq
MIRT1317089	hsa-miR-3945	CLIP-seq
MIRT1317091	hsa-miR-4419b	CLIP-seq
MIRT1317093	hsa-miR-4478	CLIP-seq
MIRT1317098	hsa-miR-4761-3p	CLIP-seq
MIRT1317079	hsa-miR-193a-3p	CLIP-seq
MIRT1317080	hsa-miR-193b	CLIP-seq
MIRT1317082	hsa-miR-3154	CLIP-seq
MIRT2094125	hsa-miR-342-3p	CLIP-seq
MIRT1317085	hsa-miR-377	CLIP-seq
MIRT1317089	hsa-miR-3945	CLIP-seq
MIRT1317092	hsa-miR-4420	CLIP-seq
MIRT2094126	hsa-miR-4643	CLIP-seq
MIRT1317098	hsa-miR-4761-3p	CLIP-seq
MIRT1317100	hsa-miR-4773	CLIP-seq
MIRT1317077	hsa-miR-1236	CLIP-seq
MIRT2318767	hsa-miR-1245b-5p	CLIP-seq
MIRT1317078	hsa-miR-151-3p	CLIP-seq
MIRT1317081	hsa-miR-2861	CLIP-seq
MIRT2318768	hsa-miR-3142	CLIP-seq
MIRT1317082	hsa-miR-3154	CLIP-seq
MIRT2094125	hsa-miR-342-3p	CLIP-seq
MIRT2318769	hsa-miR-3671	CLIP-seq
MIRT1317085	hsa-miR-377	CLIP-seq
MIRT1317086	hsa-miR-3918	CLIP-seq
MIRT1317088	hsa-miR-3929	CLIP-seq
MIRT1317089	hsa-miR-3945	CLIP-seq
MIRT1317091	hsa-miR-4419b	CLIP-seq
MIRT1317093	hsa-miR-4478	CLIP-seq
MIRT2318770	hsa-miR-4493	CLIP-seq
MIRT1317094	hsa-miR-4512	CLIP-seq
MIRT1317095	hsa-miR-4635	CLIP-seq
MIRT2094126	hsa-miR-4643	CLIP-seq
MIRT1317096	hsa-miR-4753-3p	CLIP-seq
MIRT1317098	hsa-miR-4761-3p	CLIP-seq
MIRT1317099	hsa-miR-4768-5p	CLIP-seq
MIRT1317100	hsa-miR-4773	CLIP-seq
MIRT1317101	hsa-miR-502-5p	CLIP-seq
MIRT2614356	hsa-miR-106a	CLIP-seq
MIRT2614357	hsa-miR-106b	CLIP-seq
MIRT2614358	hsa-miR-1207-5p	CLIP-seq
MIRT1317077	hsa-miR-1236	CLIP-seq
MIRT2318767	hsa-miR-1245b-5p	CLIP-seq
MIRT2614359	hsa-miR-1323	CLIP-seq
MIRT1317078	hsa-miR-151-3p	CLIP-seq
MIRT2614360	hsa-miR-17	CLIP-seq
MIRT2614361	hsa-miR-1909	CLIP-seq
MIRT1317079	hsa-miR-193a-3p	CLIP-seq
MIRT1317080	hsa-miR-193b	CLIP-seq
MIRT2614362	hsa-miR-20a	CLIP-seq
MIRT2614363	hsa-miR-20b	CLIP-seq
MIRT1317081	hsa-miR-2861	CLIP-seq
MIRT2614364	hsa-miR-296-5p	CLIP-seq
MIRT2614365	hsa-miR-3064-3p	CLIP-seq
MIRT2614366	hsa-miR-3120-3p	CLIP-seq
MIRT2614367	hsa-miR-3121-5p	CLIP-seq
MIRT2318768	hsa-miR-3142	CLIP-seq
MIRT1317082	hsa-miR-3154	CLIP-seq
MIRT1317083	hsa-miR-3156-3p	CLIP-seq
MIRT1317084	hsa-miR-3176	CLIP-seq
MIRT2614368	hsa-miR-331-3p	CLIP-seq
MIRT2614369	hsa-miR-3605-5p	CLIP-seq
MIRT2614370	hsa-miR-3620	CLIP-seq
MIRT2614371	hsa-miR-3647-3p	CLIP-seq
MIRT2318769	hsa-miR-3671	CLIP-seq
MIRT1317085	hsa-miR-377	CLIP-seq
MIRT1317086	hsa-miR-3918	CLIP-seq
MIRT1317087	hsa-miR-3922-3p	CLIP-seq
MIRT1317088	hsa-miR-3929	CLIP-seq
MIRT1317089	hsa-miR-3945	CLIP-seq
MIRT2614372	hsa-miR-4254	CLIP-seq
MIRT2614373	hsa-miR-4269	CLIP-seq
MIRT2614374	hsa-miR-4292	CLIP-seq
MIRT1317090	hsa-miR-4301	CLIP-seq
MIRT2614375	hsa-miR-4308	CLIP-seq
MIRT2614376	hsa-miR-4313	CLIP-seq
MIRT1317091	hsa-miR-4419b	CLIP-seq
MIRT1317092	hsa-miR-4420	CLIP-seq
MIRT1317093	hsa-miR-4478	CLIP-seq
MIRT2318770	hsa-miR-4493	CLIP-seq
MIRT1317094	hsa-miR-4512	CLIP-seq
MIRT1317095	hsa-miR-4635	CLIP-seq
MIRT2614377	hsa-miR-4722-3p	CLIP-seq
MIRT1317096	hsa-miR-4753-3p	CLIP-seq
MIRT1317097	hsa-miR-4757-5p	CLIP-seq
MIRT1317098	hsa-miR-4761-3p	CLIP-seq
MIRT2614378	hsa-miR-4763-3p	CLIP-seq
MIRT2614379	hsa-miR-4763-5p	CLIP-seq
MIRT2614380	hsa-miR-4767	CLIP-seq
MIRT1317099	hsa-miR-4768-5p	CLIP-seq
MIRT1317100	hsa-miR-4773	CLIP-seq
MIRT1317101	hsa-miR-502-5p	CLIP-seq
MIRT2614381	hsa-miR-519a	CLIP-seq
MIRT2614382	hsa-miR-519b-3p	CLIP-seq
MIRT2614383	hsa-miR-519c-3p	CLIP-seq
MIRT2614384	hsa-miR-519d	CLIP-seq
MIRT2614385	hsa-miR-520g	CLIP-seq
MIRT2614386	hsa-miR-520h	CLIP-seq
MIRT1317102	hsa-miR-532-3p	CLIP-seq
MIRT2614387	hsa-miR-545	CLIP-seq
MIRT2614388	hsa-miR-548o	CLIP-seq
MIRT2614389	hsa-miR-765	CLIP-seq
MIRT2614390	hsa-miR-93	CLIP-seq
MIRT2614356	hsa-miR-106a	CLIP-seq
MIRT2614357	hsa-miR-106b	CLIP-seq
MIRT2614358	hsa-miR-1207-5p	CLIP-seq
MIRT1317077	hsa-miR-1236	CLIP-seq
MIRT2318767	hsa-miR-1245b-5p	CLIP-seq
MIRT2614359	hsa-miR-1323	CLIP-seq
MIRT1317078	hsa-miR-151-3p	CLIP-seq
MIRT2614360	hsa-miR-17	CLIP-seq
MIRT2614361	hsa-miR-1909	CLIP-seq
MIRT1317079	hsa-miR-193a-3p	CLIP-seq
MIRT1317080	hsa-miR-193b	CLIP-seq
MIRT2689950	hsa-miR-2052	CLIP-seq
MIRT2614362	hsa-miR-20a	CLIP-seq
MIRT2614363	hsa-miR-20b	CLIP-seq
MIRT1317081	hsa-miR-2861	CLIP-seq
MIRT2614364	hsa-miR-296-5p	CLIP-seq
MIRT2614365	hsa-miR-3064-3p	CLIP-seq
MIRT2614366	hsa-miR-3120-3p	CLIP-seq
MIRT2614367	hsa-miR-3121-5p	CLIP-seq
MIRT2318768	hsa-miR-3142	CLIP-seq
MIRT1317082	hsa-miR-3154	CLIP-seq
MIRT1317083	hsa-miR-3156-3p	CLIP-seq
MIRT1317084	hsa-miR-3176	CLIP-seq
MIRT2614368	hsa-miR-331-3p	CLIP-seq
MIRT2614369	hsa-miR-3605-5p	CLIP-seq
MIRT2614370	hsa-miR-3620	CLIP-seq
MIRT2614371	hsa-miR-3647-3p	CLIP-seq
MIRT2318769	hsa-miR-3671	CLIP-seq
MIRT1317085	hsa-miR-377	CLIP-seq
MIRT1317086	hsa-miR-3918	CLIP-seq
MIRT1317087	hsa-miR-3922-3p	CLIP-seq
MIRT1317088	hsa-miR-3929	CLIP-seq
MIRT1317089	hsa-miR-3945	CLIP-seq
MIRT2614372	hsa-miR-4254	CLIP-seq
MIRT2614373	hsa-miR-4269	CLIP-seq
MIRT2614374	hsa-miR-4292	CLIP-seq
MIRT1317090	hsa-miR-4301	CLIP-seq
MIRT2689951	hsa-miR-4307	CLIP-seq
MIRT2614375	hsa-miR-4308	CLIP-seq
MIRT2614376	hsa-miR-4313	CLIP-seq
MIRT1317091	hsa-miR-4419b	CLIP-seq
MIRT1317092	hsa-miR-4420	CLIP-seq
MIRT1317093	hsa-miR-4478	CLIP-seq
MIRT2318770	hsa-miR-4493	CLIP-seq
MIRT1317094	hsa-miR-4512	CLIP-seq
MIRT1317095	hsa-miR-4635	CLIP-seq
MIRT2614377	hsa-miR-4722-3p	CLIP-seq
MIRT1317096	hsa-miR-4753-3p	CLIP-seq
MIRT1317097	hsa-miR-4757-5p	CLIP-seq
MIRT1317098	hsa-miR-4761-3p	CLIP-seq
MIRT2614378	hsa-miR-4763-3p	CLIP-seq
MIRT2614379	hsa-miR-4763-5p	CLIP-seq
MIRT2614380	hsa-miR-4767	CLIP-seq
MIRT1317099	hsa-miR-4768-5p	CLIP-seq
MIRT1317100	hsa-miR-4773	CLIP-seq
MIRT1317101	hsa-miR-502-5p	CLIP-seq
MIRT2614381	hsa-miR-519a	CLIP-seq
MIRT2614382	hsa-miR-519b-3p	CLIP-seq
MIRT2614383	hsa-miR-519c-3p	CLIP-seq
MIRT2614384	hsa-miR-519d	CLIP-seq
MIRT2614385	hsa-miR-520g	CLIP-seq
MIRT2614386	hsa-miR-520h	CLIP-seq
MIRT1317102	hsa-miR-532-3p	CLIP-seq
MIRT2614387	hsa-miR-545	CLIP-seq
MIRT2614388	hsa-miR-548o	CLIP-seq
MIRT2614389	hsa-miR-765	CLIP-seq
MIRT2614390	hsa-miR-93	CLIP-seq

Gene ontology (GO) Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0004579	Function	Dolichyl-diphosphooligosaccharide-protein glycotransferase activity	TAS	15835887
GO:0005515	Function	Protein binding	IPI	19167329, 22988243, 25416956, 30021884, 31515488, 31831667, 32296183, 32707033, 35271311
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	NAS	31831667
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005791	Component	Rough endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006486	Process	Protein glycosylation	IEA
GO:0006487	Process	Protein N-linked glycosylation	IDA	9642163
GO:0006487	Process	Protein N-linked glycosylation	NAS	31831667
GO:0008250	Component	Oligosaccharyltransferase complex	IBA
GO:0008250	Component	Oligosaccharyltransferase complex	IDA	9642163
GO:0008250	Component	Oligosaccharyltransferase complex	IEA
GO:0008250	Component	Oligosaccharyltransferase complex	IPI	31831667
GO:0008250	Component	Oligosaccharyltransferase complex	NAS	31831667
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0018279	Process	Protein N-linked glycosylation via asparagine	IBA
GO:0018279	Process	Protein N-linked glycosylation via asparagine	IMP	17264154
GO:0042470	Component	Melanosome	IEA
GO:0160226	Component	Oligosaccharyltransferase complex A	IDA	31831667, 36697828, 38670073
GO:0160227	Component	Oligosaccharyltransferase complex B	IDA	31831667

Other IDs

• MIM: 180470
• HGNC: 10381
• e!Ensembl: ENSG00000163902

Protein

• UniProt ID: P04843
• Protein name: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67 kDa subunit) (Ribophorin I) (RPN-I) (Ribophorin-1)
• Protein function: Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr
• PDB: 6S7O , 6S7T , 8B6L , 8PN9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04597	Ribophorin_I	31 → 457	Ribophorin I	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in all tissues tested. {ECO:0000269|PubMed:12887896}.
• Sequence:

  MEAPAAGLFLLLLLGTWAPAPGSASSEAPPLINEDVKRTVDLSSHLAKVTAEVVLAHLGG
  GSTSRATSFLLALEPELEARLAHLGVQVKGEDEEENNLEVRETKIKGKSGRFFTVKLPVA
  LDPGAKISVIVETVYTHVLHPYPTQITQSEKQFVVFEGNHYFYSPYPTKTQTMRVKLASR
  NVESYTKLGNPTRSEDLLDYGPFRDVPAYSQDTFKVHYENNSPFLTITSMTRVIEVSHWG
  NIAVEENVDLKHTGAVLKGPFSRYDYQRQPDSGISSIRSFKTILPAAAQDVYYRDEIGNV
  STSHLLILDDSVEMEIRPRFPLFGGWKTHYIVGYNLPSYEYLYNLGDQYALKMRFVDHVF
  DEQVIDSLTVKIILPEGAKNIEIDSPYEISRAPDELHYTYLDTFGRPVIVAYKKNLVEQH
  IQDIVVHYTFNKVLMLQEPLLVVAAFYILFFTVIIYVRLDFSITKDPAAEARMKVACITE
  QVLTLVNKRIGLYRHFDETVNRYKQSRDISTLNSGKKSLETEHKALTSEIALLQSRLKTE
  GSDLCDRVSEMQKLDAQVKELVLKSAVEAERLVAGKLKKDTYIENEKLISGKRQELVTKI
  DHILDAL

• Sequence length: 607

Pathways

KEGG Pathway	Reactome Pathway
N-Glycan biosynthesis	Asparagine N-linked glycosylation
Various types of N-glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (7)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Cervical cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	31178898	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary breast ovarian cancer syndrome	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYELOPROLIFERATIVE DISORDER	—	GWAS catalog	33057200, 37684235	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (14)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute myeloid leukemia with inv(3)(q21q26.2) or t(3;3)(q21;q26.2)	Myeloid Leukemia With Inv(3)(Q21q26.2) Or T(3;3)(Q21;Q26.2)	Orphanet			★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	35766008	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	30170727		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36378050	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	23314186		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	23314186		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	23314186	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	23314186		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	39993959	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	GWASCAT_DG	31178898		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	12557231		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	20556821, 7919381	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	20556821, 7919381		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	35192775	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

DAD1 4 shared pathwaysN-Glycan biosynthesis, Various types of N-glycan biosynthesis, Protein processing in endoplasmic reticulum, Asparagine N-linked glycosylation Related via 4 shared pathways including N-Glycan biosynthesis, Various types of N-glycan biosynthesis. DDOST 4 shared pathwaysN-Glycan biosynthesis, Various types of N-glycan biosynthesis, Protein processing in endoplasmic reticulum, Asparagine N-linked glycosylation Related via 4 shared pathways including N-Glycan biosynthesis, Various types of N-glycan biosynthesis. STT3A 4 shared pathwaysN-Glycan biosynthesis, Various types of N-glycan biosynthesis, Protein processing in endoplasmic reticulum, Asparagine N-linked glycosylation Related via 4 shared pathways including N-Glycan biosynthesis, Various types of N-glycan biosynthesis. RPN2 4 shared pathwaysN-Glycan biosynthesis, Various types of N-glycan biosynthesis, Protein processing in endoplasmic reticulum, Asparagine N-linked glycosylation Related via 4 shared pathways including N-Glycan biosynthesis, Various types of N-glycan biosynthesis. TUSC3 4 shared pathwaysN-Glycan biosynthesis, Various types of N-glycan biosynthesis, Protein processing in endoplasmic reticulum, Asparagine N-linked glycosylation Related via 4 shared pathways including N-Glycan biosynthesis, Various types of N-glycan biosynthesis.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
DAD1	0	[]	4	["N-Glycan biosynthesis","Various types of N-glycan biosynthesis","Protein processing in endoplasmic reticulum","Asparagine N-linked glycosylation"]	0	[]
DDOST	0	[]	4	["N-Glycan biosynthesis","Various types of N-glycan biosynthesis","Protein processing in endoplasmic reticulum","Asparagine N-linked glycosylation"]	0	[]
STT3A	0	[]	4	["N-Glycan biosynthesis","Various types of N-glycan biosynthesis","Protein processing in endoplasmic reticulum","Asparagine N-linked glycosylation"]	0	[]
RPN2	0	[]	4	["N-Glycan biosynthesis","Various types of N-glycan biosynthesis","Protein processing in endoplasmic reticulum","Asparagine N-linked glycosylation"]	0	[]
TUSC3	0	[]	4	["N-Glycan biosynthesis","Various types of N-glycan biosynthesis","Protein processing in endoplasmic reticulum","Asparagine N-linked glycosylation"]	0	[]

Diseases Linked via Similar Genes

Congenital disorder of glycosylation Linked via 4 of 5 related genesDDOST, STT3A, RPN2, TUSC3 Intellectual developmental disorder Linked via 2 of 5 related genesDDOST, TUSC3 Attention deficit hyperactivity disorder Linked via 2 of 5 related genesSTT3A, TUSC3 Crohn disease Linked via 1 of 5 related genesDAD1 Ocular hypertension Linked via 1 of 5 related genesDDOST

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Congenital disorder of glycosylation	4	["DDOST","STT3A","RPN2","TUSC3"]
Intellectual developmental disorder	2	["DDOST","TUSC3"]
Attention deficit hyperactivity disorder	2	["STT3A","TUSC3"]
Crohn disease	1	["DAD1"]
Ocular hypertension	1	["DDOST"]