DAD1 (defender against cell death 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 1603
• Gene name: Defender against cell death 1
• Gene symbol: DAD1
• Synonyms (NCBI Gene): OST2
• Chromosome: 14
• Chromosome location: 14q11.2
• Summary: DAD1, the defender against apoptotic cell death, was initially identified as a negative regulator of programmed cell death in the temperature sensitive tsBN7 cell line. The DAD1 protein disappeared in temperature-sensitive cells following a shift to the

miRNA Show/Hide all (257)

miRTarBase ID	miRNA	Experiments	Reference
MIRT552177	hsa-miR-4668-3p	PAR-CLIP	21572407
MIRT552175	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT552174	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT552173	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT552172	hsa-miR-302a-3p	PAR-CLIP	21572407
MIRT552171	hsa-miR-302b-3p	PAR-CLIP	21572407
MIRT552170	hsa-miR-302c-3p	PAR-CLIP	21572407
MIRT552169	hsa-miR-302d-3p	PAR-CLIP	21572407
MIRT552168	hsa-miR-302e	PAR-CLIP	21572407
MIRT552167	hsa-miR-372-3p	PAR-CLIP	21572407
MIRT552166	hsa-miR-373-3p	PAR-CLIP	21572407
MIRT552165	hsa-miR-520a-3p	PAR-CLIP	21572407
MIRT552164	hsa-miR-520b	PAR-CLIP	21572407
MIRT552163	hsa-miR-520c-3p	PAR-CLIP	21572407
MIRT552162	hsa-miR-520d-3p	PAR-CLIP	21572407
MIRT552161	hsa-miR-520e	PAR-CLIP	21572407
MIRT552159	hsa-miR-4274	PAR-CLIP	21572407
MIRT552160	hsa-miR-4519	PAR-CLIP	21572407
MIRT552158	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT552157	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT552156	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT552155	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT552154	hsa-miR-3666	PAR-CLIP	21572407
MIRT552153	hsa-miR-4295	PAR-CLIP	21572407
MIRT552152	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT552151	hsa-miR-4762-5p	PAR-CLIP	21572407
MIRT552150	hsa-miR-4716-5p	PAR-CLIP	21572407
MIRT552149	hsa-miR-3185	PAR-CLIP	21572407
MIRT137897	hsa-miR-621	PAR-CLIP	21572407
MIRT552148	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT552147	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT440851	hsa-miR-382-5p	HITS-CLIP	24374217
MIRT552148	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT552147	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT440851	hsa-miR-382-5p	HITS-CLIP	24374217
MIRT552158	hsa-miR-130a-3p	PAR-CLIP	27292025
MIRT552157	hsa-miR-130b-3p	PAR-CLIP	27292025
MIRT552148	hsa-miR-19a-3p	PAR-CLIP	27292025
MIRT552147	hsa-miR-19b-3p	PAR-CLIP	27292025
MIRT552156	hsa-miR-301a-3p	PAR-CLIP	27292025
MIRT552155	hsa-miR-301b-3p	PAR-CLIP	27292025
MIRT552172	hsa-miR-302a-3p	PAR-CLIP	27292025
MIRT552171	hsa-miR-302b-3p	PAR-CLIP	27292025
MIRT552170	hsa-miR-302c-3p	PAR-CLIP	27292025
MIRT552169	hsa-miR-302d-3p	PAR-CLIP	27292025
MIRT552168	hsa-miR-302e	PAR-CLIP	27292025
MIRT552149	hsa-miR-3185	PAR-CLIP	27292025
MIRT552154	hsa-miR-3666	PAR-CLIP	27292025
MIRT552167	hsa-miR-372-3p	PAR-CLIP	27292025
MIRT552166	hsa-miR-373-3p	PAR-CLIP	27292025
MIRT552159	hsa-miR-4274	PAR-CLIP	27292025
MIRT552153	hsa-miR-4295	PAR-CLIP	27292025
MIRT552160	hsa-miR-4519	PAR-CLIP	27292025
MIRT552152	hsa-miR-454-3p	PAR-CLIP	27292025
MIRT552177	hsa-miR-4668-3p	PAR-CLIP	27292025
MIRT552150	hsa-miR-4716-5p	PAR-CLIP	27292025
MIRT552151	hsa-miR-4762-5p	PAR-CLIP	27292025
MIRT552175	hsa-miR-519a-3p	PAR-CLIP	27292025
MIRT552174	hsa-miR-519b-3p	PAR-CLIP	27292025
MIRT552173	hsa-miR-519c-3p	PAR-CLIP	27292025
MIRT552165	hsa-miR-520a-3p	PAR-CLIP	27292025
MIRT552164	hsa-miR-520b	PAR-CLIP	27292025
MIRT552163	hsa-miR-520c-3p	PAR-CLIP	27292025
MIRT552162	hsa-miR-520d-3p	PAR-CLIP	27292025
MIRT552161	hsa-miR-520e	PAR-CLIP	27292025
MIRT137897	hsa-miR-621	PAR-CLIP	27292025
MIRT552177	hsa-miR-4668-3p	PAR-CLIP	21572407
MIRT552175	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT552174	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT552173	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT552172	hsa-miR-302a-3p	PAR-CLIP	21572407
MIRT552171	hsa-miR-302b-3p	PAR-CLIP	21572407
MIRT552170	hsa-miR-302c-3p	PAR-CLIP	21572407
MIRT552169	hsa-miR-302d-3p	PAR-CLIP	21572407
MIRT552168	hsa-miR-302e	PAR-CLIP	21572407
MIRT552167	hsa-miR-372-3p	PAR-CLIP	21572407
MIRT552166	hsa-miR-373-3p	PAR-CLIP	21572407
MIRT552165	hsa-miR-520a-3p	PAR-CLIP	21572407
MIRT552164	hsa-miR-520b	PAR-CLIP	21572407
MIRT552163	hsa-miR-520c-3p	PAR-CLIP	21572407
MIRT552162	hsa-miR-520d-3p	PAR-CLIP	21572407
MIRT552161	hsa-miR-520e	PAR-CLIP	21572407
MIRT552159	hsa-miR-4274	PAR-CLIP	21572407
MIRT552160	hsa-miR-4519	PAR-CLIP	21572407
MIRT552158	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT552157	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT552156	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT552155	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT552154	hsa-miR-3666	PAR-CLIP	21572407
MIRT552153	hsa-miR-4295	PAR-CLIP	21572407
MIRT552152	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT552151	hsa-miR-4762-5p	PAR-CLIP	21572407
MIRT552150	hsa-miR-4716-5p	PAR-CLIP	21572407
MIRT552149	hsa-miR-3185	PAR-CLIP	21572407
MIRT137897	hsa-miR-621	PAR-CLIP	21572407
MIRT552148	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT552147	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT922705	hsa-miR-130a	CLIP-seq
MIRT922706	hsa-miR-130b	CLIP-seq
MIRT922707	hsa-miR-19a	CLIP-seq
MIRT922708	hsa-miR-19b	CLIP-seq
MIRT922709	hsa-miR-301a	CLIP-seq
MIRT922710	hsa-miR-301b	CLIP-seq
MIRT922711	hsa-miR-302a	CLIP-seq
MIRT922712	hsa-miR-302b	CLIP-seq
MIRT922713	hsa-miR-302c	CLIP-seq
MIRT922714	hsa-miR-302d	CLIP-seq
MIRT922715	hsa-miR-372	CLIP-seq
MIRT922716	hsa-miR-373	CLIP-seq
MIRT922717	hsa-miR-454	CLIP-seq
MIRT922718	hsa-miR-519a	CLIP-seq
MIRT1973327	hsa-miR-128	CLIP-seq
MIRT1973328	hsa-miR-1285	CLIP-seq
MIRT922705	hsa-miR-130a	CLIP-seq
MIRT922706	hsa-miR-130b	CLIP-seq
MIRT1973329	hsa-miR-1976	CLIP-seq
MIRT922707	hsa-miR-19a	CLIP-seq
MIRT922708	hsa-miR-19b	CLIP-seq
MIRT1973330	hsa-miR-22	CLIP-seq
MIRT922709	hsa-miR-301a	CLIP-seq
MIRT922710	hsa-miR-301b	CLIP-seq
MIRT922711	hsa-miR-302a	CLIP-seq
MIRT922712	hsa-miR-302b	CLIP-seq
MIRT922713	hsa-miR-302c	CLIP-seq
MIRT922714	hsa-miR-302d	CLIP-seq
MIRT1973331	hsa-miR-3119	CLIP-seq
MIRT1973332	hsa-miR-3187-5p	CLIP-seq
MIRT1973333	hsa-miR-326	CLIP-seq
MIRT1973334	hsa-miR-330-5p	CLIP-seq
MIRT1973335	hsa-miR-3660	CLIP-seq
MIRT922715	hsa-miR-372	CLIP-seq
MIRT922716	hsa-miR-373	CLIP-seq
MIRT1973336	hsa-miR-378g	CLIP-seq
MIRT1973337	hsa-miR-4256	CLIP-seq
MIRT1973338	hsa-miR-4279	CLIP-seq
MIRT1973339	hsa-miR-4486	CLIP-seq
MIRT1973340	hsa-miR-4526	CLIP-seq
MIRT922717	hsa-miR-454	CLIP-seq
MIRT922718	hsa-miR-519a	CLIP-seq
MIRT1973341	hsa-miR-612	CLIP-seq
MIRT1973342	hsa-miR-642b	CLIP-seq
MIRT1973327	hsa-miR-128	CLIP-seq
MIRT1973328	hsa-miR-1285	CLIP-seq
MIRT922705	hsa-miR-130a	CLIP-seq
MIRT922706	hsa-miR-130b	CLIP-seq
MIRT1973329	hsa-miR-1976	CLIP-seq
MIRT922707	hsa-miR-19a	CLIP-seq
MIRT922708	hsa-miR-19b	CLIP-seq
MIRT1973330	hsa-miR-22	CLIP-seq
MIRT922709	hsa-miR-301a	CLIP-seq
MIRT922710	hsa-miR-301b	CLIP-seq
MIRT922711	hsa-miR-302a	CLIP-seq
MIRT922712	hsa-miR-302b	CLIP-seq
MIRT922713	hsa-miR-302c	CLIP-seq
MIRT922714	hsa-miR-302d	CLIP-seq
MIRT1973331	hsa-miR-3119	CLIP-seq
MIRT1973332	hsa-miR-3187-5p	CLIP-seq
MIRT1973333	hsa-miR-326	CLIP-seq
MIRT1973334	hsa-miR-330-5p	CLIP-seq
MIRT922715	hsa-miR-372	CLIP-seq
MIRT922716	hsa-miR-373	CLIP-seq
MIRT1973336	hsa-miR-378g	CLIP-seq
MIRT1973338	hsa-miR-4279	CLIP-seq
MIRT1973339	hsa-miR-4486	CLIP-seq
MIRT922717	hsa-miR-454	CLIP-seq
MIRT2208922	hsa-miR-488	CLIP-seq
MIRT922718	hsa-miR-519a	CLIP-seq
MIRT2208923	hsa-miR-543	CLIP-seq
MIRT2208924	hsa-miR-548an	CLIP-seq
MIRT1973341	hsa-miR-612	CLIP-seq
MIRT1973342	hsa-miR-642b	CLIP-seq
MIRT1973327	hsa-miR-128	CLIP-seq
MIRT1973328	hsa-miR-1285	CLIP-seq
MIRT922705	hsa-miR-130a	CLIP-seq
MIRT922706	hsa-miR-130b	CLIP-seq
MIRT1973329	hsa-miR-1976	CLIP-seq
MIRT922707	hsa-miR-19a	CLIP-seq
MIRT922708	hsa-miR-19b	CLIP-seq
MIRT922709	hsa-miR-301a	CLIP-seq
MIRT922710	hsa-miR-301b	CLIP-seq
MIRT922711	hsa-miR-302a	CLIP-seq
MIRT922712	hsa-miR-302b	CLIP-seq
MIRT922713	hsa-miR-302c	CLIP-seq
MIRT922714	hsa-miR-302d	CLIP-seq
MIRT1973331	hsa-miR-3119	CLIP-seq
MIRT1973332	hsa-miR-3187-5p	CLIP-seq
MIRT1973333	hsa-miR-326	CLIP-seq
MIRT1973334	hsa-miR-330-5p	CLIP-seq
MIRT922715	hsa-miR-372	CLIP-seq
MIRT922716	hsa-miR-373	CLIP-seq
MIRT1973336	hsa-miR-378g	CLIP-seq
MIRT1973338	hsa-miR-4279	CLIP-seq
MIRT1973339	hsa-miR-4486	CLIP-seq
MIRT922717	hsa-miR-454	CLIP-seq
MIRT922718	hsa-miR-519a	CLIP-seq
MIRT1973341	hsa-miR-612	CLIP-seq
MIRT1973342	hsa-miR-642b	CLIP-seq
MIRT1973327	hsa-miR-128	CLIP-seq
MIRT1973328	hsa-miR-1285	CLIP-seq
MIRT922705	hsa-miR-130a	CLIP-seq
MIRT922706	hsa-miR-130b	CLIP-seq
MIRT1973329	hsa-miR-1976	CLIP-seq
MIRT922707	hsa-miR-19a	CLIP-seq
MIRT922708	hsa-miR-19b	CLIP-seq
MIRT1973330	hsa-miR-22	CLIP-seq
MIRT922709	hsa-miR-301a	CLIP-seq
MIRT922710	hsa-miR-301b	CLIP-seq
MIRT922711	hsa-miR-302a	CLIP-seq
MIRT922712	hsa-miR-302b	CLIP-seq
MIRT922713	hsa-miR-302c	CLIP-seq
MIRT922714	hsa-miR-302d	CLIP-seq
MIRT1973331	hsa-miR-3119	CLIP-seq
MIRT1973332	hsa-miR-3187-5p	CLIP-seq
MIRT1973333	hsa-miR-326	CLIP-seq
MIRT1973334	hsa-miR-330-5p	CLIP-seq
MIRT922715	hsa-miR-372	CLIP-seq
MIRT922716	hsa-miR-373	CLIP-seq
MIRT1973336	hsa-miR-378g	CLIP-seq
MIRT1973338	hsa-miR-4279	CLIP-seq
MIRT2512777	hsa-miR-4474-5p	CLIP-seq
MIRT1973339	hsa-miR-4486	CLIP-seq
MIRT922717	hsa-miR-454	CLIP-seq
MIRT922718	hsa-miR-519a	CLIP-seq
MIRT2208923	hsa-miR-543	CLIP-seq
MIRT1973341	hsa-miR-612	CLIP-seq
MIRT1973342	hsa-miR-642b	CLIP-seq
MIRT2512778	hsa-miR-766	CLIP-seq
MIRT1973327	hsa-miR-128	CLIP-seq
MIRT1973328	hsa-miR-1285	CLIP-seq
MIRT922705	hsa-miR-130a	CLIP-seq
MIRT922706	hsa-miR-130b	CLIP-seq
MIRT1973329	hsa-miR-1976	CLIP-seq
MIRT922707	hsa-miR-19a	CLIP-seq
MIRT922708	hsa-miR-19b	CLIP-seq
MIRT1973330	hsa-miR-22	CLIP-seq
MIRT922709	hsa-miR-301a	CLIP-seq
MIRT922710	hsa-miR-301b	CLIP-seq
MIRT922711	hsa-miR-302a	CLIP-seq
MIRT922712	hsa-miR-302b	CLIP-seq
MIRT922713	hsa-miR-302c	CLIP-seq
MIRT922714	hsa-miR-302d	CLIP-seq
MIRT1973331	hsa-miR-3119	CLIP-seq
MIRT1973332	hsa-miR-3187-5p	CLIP-seq
MIRT1973333	hsa-miR-326	CLIP-seq
MIRT1973334	hsa-miR-330-5p	CLIP-seq
MIRT922715	hsa-miR-372	CLIP-seq
MIRT922716	hsa-miR-373	CLIP-seq
MIRT1973336	hsa-miR-378g	CLIP-seq
MIRT1973338	hsa-miR-4279	CLIP-seq
MIRT2512777	hsa-miR-4474-5p	CLIP-seq
MIRT1973339	hsa-miR-4486	CLIP-seq
MIRT922717	hsa-miR-454	CLIP-seq
MIRT922718	hsa-miR-519a	CLIP-seq
MIRT2208923	hsa-miR-543	CLIP-seq
MIRT1973341	hsa-miR-612	CLIP-seq
MIRT1973342	hsa-miR-642b	CLIP-seq
MIRT2512778	hsa-miR-766	CLIP-seq

Gene ontology (GO) Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001824	Process	Blastocyst development	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	NAS	31831667
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006486	Process	Protein glycosylation	IEA
GO:0006486	Process	Protein glycosylation	ISS
GO:0006487	Process	Protein N-linked glycosylation	IBA
GO:0006487	Process	Protein N-linked glycosylation	NAS	31831667
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0008047	Function	Enzyme activator activity	IMP	22467853
GO:0008250	Component	Oligosaccharyltransferase complex	IBA
GO:0008250	Component	Oligosaccharyltransferase complex	IDA	22467853
GO:0008250	Component	Oligosaccharyltransferase complex	IEA
GO:0008250	Component	Oligosaccharyltransferase complex	IPI	31831667
GO:0008250	Component	Oligosaccharyltransferase complex	ISS
GO:0008250	Component	Oligosaccharyltransferase complex	NAS	31831667
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0018279	Process	Protein N-linked glycosylation via asparagine	IMP	22467853
GO:0031647	Process	Regulation of protein stability	IMP	22467853
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	TAS	8413235
GO:0160226	Component	Oligosaccharyltransferase complex A	IDA	31831667, 36697828, 38670073
GO:0160227	Component	Oligosaccharyltransferase complex B	IDA	31831667

Other IDs

• MIM: 600243
• HGNC: 2664
• e!Ensembl: ENSG00000129562

Protein

• UniProt ID: P61803
• Protein name: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (Oligosaccharyl transferase subunit DAD1) (Defender against cell death 1) (DAD-1)
• Protein function: Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr
• PDB: 6S7O , 6S7T , 8B6L , 8PN9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02109	DAD	5 → 113	DAD family	Family

• Sequence:

  MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGF
  ISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG

• Sequence length: 113

Pathways

KEGG Pathway	Reactome Pathway
N-Glycan biosynthesis	Asparagine N-linked glycosylation
Various types of N-glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
CROHN'S DISEASE	—	GWAS catalog	30801121	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (16)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Asthma	Asthma	Pubtator	26635092	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30032071		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	15824739		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27039262	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	11335099	Associate	★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	26635092		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	17094974	Associate	★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	15824739		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27451077		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	40528211	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12969976	Associate	★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	21606320		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	15175081		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	27039262	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	16116477		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	40528211	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

DDOST 4 shared pathwaysN-Glycan biosynthesis, Various types of N-glycan biosynthesis, Protein processing in endoplasmic reticulum, Asparagine N-linked glycosylation Related via 4 shared pathways including N-Glycan biosynthesis, Various types of N-glycan biosynthesis. STT3A 4 shared pathwaysN-Glycan biosynthesis, Various types of N-glycan biosynthesis, Protein processing in endoplasmic reticulum, Asparagine N-linked glycosylation Related via 4 shared pathways including N-Glycan biosynthesis, Various types of N-glycan biosynthesis. RPN1 4 shared pathwaysN-Glycan biosynthesis, Various types of N-glycan biosynthesis, Protein processing in endoplasmic reticulum, Asparagine N-linked glycosylation Related via 4 shared pathways including N-Glycan biosynthesis, Various types of N-glycan biosynthesis. RPN2 4 shared pathwaysN-Glycan biosynthesis, Various types of N-glycan biosynthesis, Protein processing in endoplasmic reticulum, Asparagine N-linked glycosylation Related via 4 shared pathways including N-Glycan biosynthesis, Various types of N-glycan biosynthesis. TUSC3 4 shared pathwaysN-Glycan biosynthesis, Various types of N-glycan biosynthesis, Protein processing in endoplasmic reticulum, Asparagine N-linked glycosylation Related via 4 shared pathways including N-Glycan biosynthesis, Various types of N-glycan biosynthesis.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
DDOST	0	[]	4	["N-Glycan biosynthesis","Various types of N-glycan biosynthesis","Protein processing in endoplasmic reticulum","Asparagine N-linked glycosylation"]	0	[]
STT3A	0	[]	4	["N-Glycan biosynthesis","Various types of N-glycan biosynthesis","Protein processing in endoplasmic reticulum","Asparagine N-linked glycosylation"]	0	[]
RPN1	0	[]	4	["N-Glycan biosynthesis","Various types of N-glycan biosynthesis","Protein processing in endoplasmic reticulum","Asparagine N-linked glycosylation"]	0	[]
RPN2	0	[]	4	["N-Glycan biosynthesis","Various types of N-glycan biosynthesis","Protein processing in endoplasmic reticulum","Asparagine N-linked glycosylation"]	0	[]
TUSC3	0	[]	4	["N-Glycan biosynthesis","Various types of N-glycan biosynthesis","Protein processing in endoplasmic reticulum","Asparagine N-linked glycosylation"]	0	[]

Diseases Linked via Similar Genes

Congenital disorder of glycosylation Linked via 4 of 5 related genesDDOST, STT3A, RPN2, TUSC3 Intellectual developmental disorder Linked via 2 of 5 related genesDDOST, TUSC3 Attention deficit hyperactivity disorder Linked via 2 of 5 related genesSTT3A, TUSC3 Ocular hypertension Linked via 1 of 5 related genesDDOST DDOST-congenital disorder of glycosylation Linked via 1 of 5 related genesDDOST

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Congenital disorder of glycosylation	4	["DDOST","STT3A","RPN2","TUSC3"]
Intellectual developmental disorder	2	["DDOST","TUSC3"]
Attention deficit hyperactivity disorder	2	["STT3A","TUSC3"]
Ocular hypertension	1	["DDOST"]
DDOST-congenital disorder of glycosylation	1	["DDOST"]