Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	80352
Gene name	Ring finger protein 39
Gene symbol	RNF39
Synonyms (NCBI Gene)	FAP216HZFHZFWLIRF
Chromosome	6
Chromosome location	6p22.1
Summary	This gene lies within the major histocompatibility complex class I region on chromosome 6. Studies of a similar rat protein suggest that this gene encodes a protein that plays a role in an early phase of synaptic plasticity. Multiple transcript variants e

77 Show/Hide all (77)

miRTarBase ID	miRNA	Experiments
MIRT1312903	hsa-miR-1257	CLIP-seq
MIRT1312904	hsa-miR-1278	CLIP-seq
MIRT1312905	hsa-miR-3918	CLIP-seq
MIRT1312906	hsa-miR-4434	CLIP-seq
MIRT1312907	hsa-miR-4481	CLIP-seq
MIRT1312908	hsa-miR-4516	CLIP-seq
MIRT1312909	hsa-miR-4745-5p	CLIP-seq
MIRT1312910	hsa-miR-4758-5p	CLIP-seq
MIRT1312911	hsa-miR-4790-3p	CLIP-seq
MIRT1312912	hsa-miR-873	CLIP-seq
MIRT2093077	hsa-miR-200b	CLIP-seq
MIRT2093078	hsa-miR-200c	CLIP-seq
MIRT2093079	hsa-miR-2052	CLIP-seq
MIRT2093080	hsa-miR-2681	CLIP-seq
MIRT2093081	hsa-miR-3150a-3p	CLIP-seq
MIRT2093082	hsa-miR-3175	CLIP-seq
MIRT2093083	hsa-miR-323b-3p	CLIP-seq
MIRT2093084	hsa-miR-4261	CLIP-seq
MIRT2093085	hsa-miR-429	CLIP-seq
MIRT2093086	hsa-miR-4468	CLIP-seq
MIRT2093087	hsa-miR-939	CLIP-seq
MIRT2317575	hsa-miR-1224-5p	CLIP-seq
MIRT2317576	hsa-miR-1255a	CLIP-seq
MIRT2317577	hsa-miR-1255b	CLIP-seq
MIRT2317578	hsa-miR-1270	CLIP-seq
MIRT2317579	hsa-miR-185	CLIP-seq
MIRT2317580	hsa-miR-1910	CLIP-seq
MIRT2317581	hsa-miR-1915	CLIP-seq
MIRT2093077	hsa-miR-200b	CLIP-seq
MIRT2093078	hsa-miR-200c	CLIP-seq
MIRT2317582	hsa-miR-2110	CLIP-seq
MIRT2317583	hsa-miR-2355-5p	CLIP-seq
MIRT2093080	hsa-miR-2681	CLIP-seq
MIRT2317584	hsa-miR-2861	CLIP-seq
MIRT2317585	hsa-miR-29a	CLIP-seq
MIRT2317586	hsa-miR-29b	CLIP-seq
MIRT2317587	hsa-miR-29c	CLIP-seq
MIRT2093081	hsa-miR-3150a-3p	CLIP-seq
MIRT2317588	hsa-miR-3150b-3p	CLIP-seq
MIRT2093082	hsa-miR-3175	CLIP-seq
MIRT2093083	hsa-miR-323b-3p	CLIP-seq
MIRT2317589	hsa-miR-3668	CLIP-seq
MIRT2317590	hsa-miR-3915	CLIP-seq
MIRT2317591	hsa-miR-3938	CLIP-seq
MIRT2317592	hsa-miR-4271	CLIP-seq
MIRT2093085	hsa-miR-429	CLIP-seq
MIRT2317593	hsa-miR-4306	CLIP-seq
MIRT1312906	hsa-miR-4434	CLIP-seq
MIRT2317594	hsa-miR-4512	CLIP-seq
MIRT1312908	hsa-miR-4516	CLIP-seq
MIRT2317595	hsa-miR-4528	CLIP-seq
MIRT2317596	hsa-miR-4530	CLIP-seq
MIRT2317597	hsa-miR-4531	CLIP-seq
MIRT2317598	hsa-miR-455-5p	CLIP-seq
MIRT2317599	hsa-miR-4644	CLIP-seq
MIRT2317600	hsa-miR-4650-5p	CLIP-seq
MIRT2317601	hsa-miR-4683	CLIP-seq
MIRT2317602	hsa-miR-4689	CLIP-seq
MIRT2317603	hsa-miR-4725-3p	CLIP-seq
MIRT2317604	hsa-miR-4726-3p	CLIP-seq
MIRT2317605	hsa-miR-4728-5p	CLIP-seq
MIRT2317606	hsa-miR-4747-5p	CLIP-seq
MIRT2317607	hsa-miR-4784	CLIP-seq
MIRT1312911	hsa-miR-4790-3p	CLIP-seq
MIRT2317608	hsa-miR-496	CLIP-seq
MIRT2317609	hsa-miR-520d-5p	CLIP-seq
MIRT2317610	hsa-miR-524-5p	CLIP-seq
MIRT2317611	hsa-miR-620	CLIP-seq
MIRT2317612	hsa-miR-634	CLIP-seq
MIRT2317613	hsa-miR-654-3p	CLIP-seq
MIRT2317614	hsa-miR-659	CLIP-seq
MIRT2317615	hsa-miR-765	CLIP-seq
MIRT2317616	hsa-miR-767-5p	CLIP-seq
MIRT2317617	hsa-miR-922	CLIP-seq
MIRT2093087	hsa-miR-939	CLIP-seq
MIRT2465986	hsa-miR-1273d	CLIP-seq
MIRT2465987	hsa-miR-3064-3p	CLIP-seq

17 Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002753	Process	Cytoplasmic pattern recognition receptor signaling pathway	IDA	23478265
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	33674311, 39255680
GO:0005737	Component	Cytoplasm	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032481	Process	Positive regulation of type I interferon production	IDA	12692549, 18636090
GO:0039532	Process	Negative regulation of cytoplasmic pattern recognition receptor signaling pathway	IDA	33674311
GO:0045087	Process	Innate immune response	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	33674311, 39255680
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	39255680
GO:0140896	Process	CGAS/STING signaling pathway	IDA	25636800
GO:0140896	Process	CGAS/STING signaling pathway	TAS	37403426
GO:0141111	Process	Positive regulation of cGAS/STING signaling pathway	IDA	39255680

MIM	HGNC	e!Ensembl
607524	18064	ENSG00000204618

Q9H2S5

Protein name

RING finger protein 39 (EC 2.3.2.27) (Protein HZFw)

Protein function

Plays an inhibitory role in anti-RNA viral innate immunity by targeting the adapter DDX3X and promoting its 'Lys-48'-linked polyubiquitination (PubMed:33674311). Alternatively, enhances the cGAS-STING pathway activation by promoting 'Lys-63'-lin

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00097	zf-C3HC4	88 → 134	Zinc finger, C3HC4 type (RING finger)	Domain
PF13765	PRY	230 → 279	SPRY-associated domain	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in testis. {ECO:0000269|PubMed:11130983}.

Sequence

MWWRDLTRLRLWLKREAIPGEGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEG
AASRSWLSMDAPELGPGLVERLEQLATCPLCGGSFEDPVLLACEHSFCRACLARRWGTPP
ATGTEASPTACPCCGLPCPRRSLRSNVRLAVEVRISRELREKLAEPGARAGRRRGGRIPT
MGCLDLPGEDMRKTWRRFEVPTSKSSNSEDDLPEDYPVVKKMLHRLTADLTLDPGTAHRR
LLISADRRSVQLAPPGTPAPPDGPKRFDQLPAVLGAQGFGAGRHCWEVETADAASCRDSS
GEDADDEESHYAVGAAGESVQRKGCVRLCPAGAVWAVEGRGGRLWALTAPEPTLLGGVEP
PPRRIRVDLDWERGRVAFYDGRSLDLLYAFQAPGPLGERIFPLFCTCDPRAPLRIVPAES

Sequence length

420

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (11)
CERVICAL CANCER	—	GWAS catalog	31488892	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	31488892	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	26956414	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHOID	—	GWAS catalog	33888516	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNE SYSTEM DISEASE	—	GWAS catalog	39537604	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	35907915	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYASTHENIA GRAVIS	—	GWAS catalog	39537604	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROTIC SYNDROME	—	GWAS catalog	37120605	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	39885523	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	39739889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID DISEASE	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (14)
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	GWASDB_DG	19836008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	20875797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	26534935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	26534935	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	26534935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	17632545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Distal Myopathies	Distal myopathy	Pubtator	38015635	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	31103287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASDB_DG	24871463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	GWASDB_DG	19654303, 22899653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	30782033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	28729889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	GWASDB_DG	23055271		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis Allergic	Rhinitis	Pubtator	28149331	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RNF39 (ring finger protein 39)

Bookmark This Gene