GMDS (GDP-mannose 4,6-dehydratase)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 2762
• Gene name: GDP-mannose 4,6-dehydratase
• Gene symbol: GMDS
• Synonyms (NCBI Gene): GMD, SDR3E1
• Chromosome: 6
• Chromosome location: 6p25.3
• Summary: GDP-mannose 4,6-dehydratase (GMD; EC 4.2.1.47) catalyzes the conversion of GDP-mannose to GDP-4-keto-6-deoxymannose, the first step in the synthesis of GDP-fucose from GDP-mannose, using NADP+ as a cofactor. The second and third steps of the pathway are c

miRNA Show/Hide all (116)

miRTarBase ID	miRNA	Experiments	Reference
MIRT712759	hsa-miR-3150a-5p	HITS-CLIP	19536157
MIRT712758	hsa-miR-3150b-5p	HITS-CLIP	19536157
MIRT712756	hsa-miR-6812-3p	HITS-CLIP	19536157
MIRT712757	hsa-miR-1307-3p	HITS-CLIP	19536157
MIRT712755	hsa-miR-744-5p	HITS-CLIP	19536157
MIRT712754	hsa-miR-1908-5p	HITS-CLIP	19536157
MIRT712753	hsa-miR-663a	HITS-CLIP	19536157
MIRT712751	hsa-miR-6787-5p	HITS-CLIP	19536157
MIRT712752	hsa-miR-3180	HITS-CLIP	19536157
MIRT712750	hsa-miR-3180-3p	HITS-CLIP	19536157
MIRT712748	hsa-miR-3196	HITS-CLIP	19536157
MIRT712749	hsa-miR-6816-5p	HITS-CLIP	19536157
MIRT712759	hsa-miR-3150a-5p	HITS-CLIP	19536157
MIRT712758	hsa-miR-3150b-5p	HITS-CLIP	19536157
MIRT712756	hsa-miR-6812-3p	HITS-CLIP	19536157
MIRT712757	hsa-miR-1307-3p	HITS-CLIP	19536157
MIRT712755	hsa-miR-744-5p	HITS-CLIP	19536157
MIRT712754	hsa-miR-1908-5p	HITS-CLIP	19536157
MIRT712753	hsa-miR-663a	HITS-CLIP	19536157
MIRT712751	hsa-miR-6787-5p	HITS-CLIP	19536157
MIRT712752	hsa-miR-3180	HITS-CLIP	19536157
MIRT712750	hsa-miR-3180-3p	HITS-CLIP	19536157
MIRT712748	hsa-miR-3196	HITS-CLIP	19536157
MIRT712749	hsa-miR-6816-5p	HITS-CLIP	19536157
MIRT712759	hsa-miR-3150a-5p	HITS-CLIP	19536157
MIRT712758	hsa-miR-3150b-5p	HITS-CLIP	19536157
MIRT712756	hsa-miR-6812-3p	HITS-CLIP	19536157
MIRT712757	hsa-miR-1307-3p	HITS-CLIP	19536157
MIRT712755	hsa-miR-744-5p	HITS-CLIP	19536157
MIRT712754	hsa-miR-1908-5p	HITS-CLIP	19536157
MIRT712753	hsa-miR-663a	HITS-CLIP	19536157
MIRT712751	hsa-miR-6787-5p	HITS-CLIP	19536157
MIRT712752	hsa-miR-3180	HITS-CLIP	19536157
MIRT712750	hsa-miR-3180-3p	HITS-CLIP	19536157
MIRT712748	hsa-miR-3196	HITS-CLIP	19536157
MIRT712749	hsa-miR-6816-5p	HITS-CLIP	19536157
MIRT526051	hsa-miR-4803	PAR-CLIP	22012620
MIRT526050	hsa-miR-5582-5p	PAR-CLIP	22012620
MIRT526049	hsa-miR-3622a-5p	PAR-CLIP	22012620
MIRT526048	hsa-miR-654-3p	PAR-CLIP	22012620
MIRT526047	hsa-miR-3128	PAR-CLIP	22012620
MIRT526046	hsa-miR-6868-5p	PAR-CLIP	22012620
MIRT526045	hsa-miR-4720-5p	PAR-CLIP	22012620
MIRT526044	hsa-miR-4799-3p	PAR-CLIP	22012620
MIRT526043	hsa-miR-5588-5p	PAR-CLIP	22012620
MIRT526042	hsa-miR-3622b-5p	PAR-CLIP	22012620
MIRT526041	hsa-miR-496	PAR-CLIP	22012620
MIRT526040	hsa-miR-3143	PAR-CLIP	22012620
MIRT526039	hsa-miR-4423-3p	PAR-CLIP	22012620
MIRT526038	hsa-miR-1231	PAR-CLIP	22012620
MIRT526037	hsa-miR-302c-5p	PAR-CLIP	22012620
MIRT440560	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440560	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT712759	hsa-miR-3150a-5p	HITS-CLIP	19536157
MIRT712758	hsa-miR-3150b-5p	HITS-CLIP	19536157
MIRT712756	hsa-miR-6812-3p	HITS-CLIP	19536157
MIRT712757	hsa-miR-1307-3p	HITS-CLIP	19536157
MIRT712755	hsa-miR-744-5p	HITS-CLIP	19536157
MIRT712754	hsa-miR-1908-5p	HITS-CLIP	19536157
MIRT712753	hsa-miR-663a	HITS-CLIP	19536157
MIRT712751	hsa-miR-6787-5p	HITS-CLIP	19536157
MIRT712752	hsa-miR-3180	HITS-CLIP	19536157
MIRT712750	hsa-miR-3180-3p	HITS-CLIP	19536157
MIRT712748	hsa-miR-3196	HITS-CLIP	19536157
MIRT712749	hsa-miR-6816-5p	HITS-CLIP	19536157
MIRT712759	hsa-miR-3150a-5p	HITS-CLIP	19536157
MIRT712758	hsa-miR-3150b-5p	HITS-CLIP	19536157
MIRT712756	hsa-miR-6812-3p	HITS-CLIP	19536157
MIRT712757	hsa-miR-1307-3p	HITS-CLIP	19536157
MIRT712755	hsa-miR-744-5p	HITS-CLIP	19536157
MIRT712754	hsa-miR-1908-5p	HITS-CLIP	19536157
MIRT712753	hsa-miR-663a	HITS-CLIP	19536157
MIRT712751	hsa-miR-6787-5p	HITS-CLIP	19536157
MIRT712752	hsa-miR-3180	HITS-CLIP	19536157
MIRT712750	hsa-miR-3180-3p	HITS-CLIP	19536157
MIRT712748	hsa-miR-3196	HITS-CLIP	19536157
MIRT712749	hsa-miR-6816-5p	HITS-CLIP	19536157
MIRT712759	hsa-miR-3150a-5p	HITS-CLIP	19536157
MIRT712758	hsa-miR-3150b-5p	HITS-CLIP	19536157
MIRT712756	hsa-miR-6812-3p	HITS-CLIP	19536157
MIRT712757	hsa-miR-1307-3p	HITS-CLIP	19536157
MIRT712755	hsa-miR-744-5p	HITS-CLIP	19536157
MIRT712754	hsa-miR-1908-5p	HITS-CLIP	19536157
MIRT712753	hsa-miR-663a	HITS-CLIP	19536157
MIRT712751	hsa-miR-6787-5p	HITS-CLIP	19536157
MIRT712752	hsa-miR-3180	HITS-CLIP	19536157
MIRT712750	hsa-miR-3180-3p	HITS-CLIP	19536157
MIRT712748	hsa-miR-3196	HITS-CLIP	19536157
MIRT712749	hsa-miR-6816-5p	HITS-CLIP	19536157
MIRT526051	hsa-miR-4803	PAR-CLIP	22012620
MIRT526050	hsa-miR-5582-5p	PAR-CLIP	22012620
MIRT526049	hsa-miR-3622a-5p	PAR-CLIP	22012620
MIRT526048	hsa-miR-654-3p	PAR-CLIP	22012620
MIRT526047	hsa-miR-3128	PAR-CLIP	22012620
MIRT526046	hsa-miR-6868-5p	PAR-CLIP	22012620
MIRT526045	hsa-miR-4720-5p	PAR-CLIP	22012620
MIRT526044	hsa-miR-4799-3p	PAR-CLIP	22012620
MIRT526043	hsa-miR-5588-5p	PAR-CLIP	22012620
MIRT526042	hsa-miR-3622b-5p	PAR-CLIP	22012620
MIRT526041	hsa-miR-496	PAR-CLIP	22012620
MIRT526040	hsa-miR-3143	PAR-CLIP	22012620
MIRT526039	hsa-miR-4423-3p	PAR-CLIP	22012620
MIRT526038	hsa-miR-1231	PAR-CLIP	22012620
MIRT526037	hsa-miR-302c-5p	PAR-CLIP	22012620
MIRT1022450	hsa-miR-1909	CLIP-seq
MIRT1022451	hsa-miR-214	CLIP-seq
MIRT1022452	hsa-miR-3197	CLIP-seq
MIRT1022453	hsa-miR-3619-5p	CLIP-seq
MIRT1022454	hsa-miR-761	CLIP-seq
MIRT1022450	hsa-miR-1909	CLIP-seq
MIRT1022452	hsa-miR-3197	CLIP-seq
MIRT2236037	hsa-miR-4493	CLIP-seq
MIRT2236038	hsa-miR-4719	CLIP-seq
MIRT2236039	hsa-miR-4758-3p	CLIP-seq
MIRT2236040	hsa-miR-513b	CLIP-seq
MIRT2236041	hsa-miR-744	CLIP-seq

Gene ontology (GO) Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005737	Component	Cytoplasm	IC	9525924
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0007219	Process	Notch signaling pathway	ISS
GO:0008446	Function	GDP-mannose 4,6-dehydratase activity	IBA
GO:0008446	Function	GDP-mannose 4,6-dehydratase activity	IDA	9525924
GO:0008446	Function	GDP-mannose 4,6-dehydratase activity	IEA
GO:0008446	Function	GDP-mannose 4,6-dehydratase activity	IGI	9603974
GO:0008446	Function	GDP-mannose 4,6-dehydratase activity	TAS
GO:0016829	Function	Lyase activity	IEA
GO:0019673	Process	GDP-mannose metabolic process	IDA	9525924
GO:0019673	Process	GDP-mannose metabolic process	IEA
GO:0019673	Process	GDP-mannose metabolic process	IGI	9603974
GO:0042350	Process	GDP-L-fucose biosynthetic process	TAS
GO:0042351	Process	'de novo' GDP-L-fucose biosynthetic process	IBA
GO:0042351	Process	'de novo' GDP-L-fucose biosynthetic process	IDA	9525924
GO:0042351	Process	'de novo' GDP-L-fucose biosynthetic process	IEA
GO:0042802	Function	Identical protein binding	IPI	16189514, 25416956, 31515488, 32296183
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0070401	Function	NADP+ binding	IDA	9525924

Other IDs

• MIM: 602884
• HGNC: 4369
• e!Ensembl: ENSG00000112699

Protein

• UniProt ID: O60547
• Protein name: GDP-mannose 4,6 dehydratase (EC 4.2.1.47) (GDP-D-mannose dehydratase) (GMD)
• Protein function: Catalyzes the conversion of GDP-D-mannose to GDP-4-dehydro-6-deoxy-D-mannose.
• PDB: 1T2A , 5IN4 , 5IN5 , 6GPJ , 6GPK , 6GPL , 6Q94
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16363	GDP_Man_Dehyd	27 → 358	GDP-mannose 4,6 dehydratase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in pancreas and small intestine. Expressed in thymus, protstate, colon, heart, placenta, liver and kidney. Expressed at low levels in spleen, testis, brain and lung. {ECO:0000269|PubMed:9525924}.
• Sequence:

  MAHAPARCPSARGSGDGEMGKPRNVALITGITGQDGSYLAEFLLEKGYEVHGIVRRSSSF
  NTGRIEHLYKNPQAHIEGNMKLHYGDLTDSTCLVKIINEVKPTEIYNLGAQSHVKISFDL
  AEYTADVDGVGTLRLLDAVKTCGLINSVKFYQASTSELYGKVQEIPQKETTPFYPRSPYG
  AAKLYAYWIVVNFREAYNLFAVNGILFNHESPRRGANFVTRKISRSVAKIYLGQLECFSL
  GNLDAKRDWGHAKDYVEAMWLMLQNDEPEDFVIATGEVHSVREFVEKSFLHIGKTIVWEG
  KNENEVGRCKETGKVHVTVDLKYYRPTEVDFLQGDCTKAKQKLNWKPRVAFDELVREMVH
  ADVELMRTNPNA

• Sequence length: 372

Pathways

KEGG Pathway	Reactome Pathway
Fructose and mannose metabolism	GDP-fucose biosynthesis
Biosynthesis of various nucleotide sugars
Metabolic pathways
Biosynthesis of nucleotide sugars

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (24)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
CARDIOVASCULAR DISEASE	—	GWAS catalog	30595370	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEAR CELL RENAL CARCINOMA	—	GWAS catalog	38671320	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	37359372	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	29212778, 36474045, 41022758	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	GWAS catalog	32589924	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	GWAS catalog	31959993	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA, OPEN-ANGLE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	31578528, 33356394, 33462484, 39406924	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHOID	—	GWAS catalog	33888516	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY CANCER	—	GWAS catalog	38671320	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET MYASTHENIA GRAVIS	—	GWAS catalog	26562150	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	33532862, 38072966	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	25173105, 29891935, 33627673, 37386247	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT	—	GWAS catalog	33137956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	40205036	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	33398198, 37945903, 38632662	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	33398198, 37945903, 38632662	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	38374256	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (21)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29843634		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	28795659		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31423008	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	26957041		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19361506, 23922970		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23922970, 27639802		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23922970	Associate	★☆☆☆☆ Found in Text Mining only
Conductive hearing loss	Hearing Loss	BEFREE	26957041		★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 2C	Congenital disorder of glycosylation	Pubtator	9662431	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29417694		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37916327	Inhibit	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	25173105	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	GWASCAT_DG	25173105, 29891935		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	25173105, 27862086		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	26957041		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	30072579	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31249452		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19361506, 23922970		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19361506, 23922970		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19361506, 22027835		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	29417694		★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

Sort by: Blended Diseases Pathways Evidence source

FCAMR 2 shared diseasesClear cell renal cell carcinoma, Kidney cancer 2 shared evidence sourcesGWAS catalog (Clear cell renal cell carcinoma), GWAS catalog (Kidney cancer) Related via 2 shared diseases including Clear cell renal cell carcinoma, Kidney cancer — evidence mostly GWAS catalog. SRBD1 2 shared diseasesGlaucoma, Hemorrhoid 2 shared evidence sourcesGWAS catalog (Glaucoma), GWAS catalog (Hemorrhoid) Related via 2 shared diseases including Glaucoma, Hemorrhoid — evidence mostly GWAS catalog. SFMBT1 3 shared diseasesClear cell renal cell carcinoma, Hemorrhoid, Kidney cancer 3 shared evidence sourcesGWAS catalog (Clear cell renal cell carcinoma), GWAS catalog (Hemorrhoid), GWAS catalog (Kidney cancer) Related via 3 shared diseases including Clear cell renal cell carcinoma, Hemorrhoid — evidence mostly GWAS catalog. DPF3 2 shared diseasesClear cell renal cell carcinoma, Kidney cancer 2 shared evidence sourcesGWAS catalog (Clear cell renal cell carcinoma), GWAS catalog (Kidney cancer) Related via 2 shared diseases including Clear cell renal cell carcinoma, Kidney cancer — evidence mostly GWAS catalog. DCAF12L1 2 shared diseasesClear cell renal cell carcinoma, Kidney cancer 2 shared evidence sourcesGWAS catalog (Clear cell renal cell carcinoma), GWAS catalog (Kidney cancer) Related via 2 shared diseases including Clear cell renal cell carcinoma, Kidney cancer — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
FCAMR	2	["Clear cell renal cell carcinoma","Kidney cancer"]	0	[]	2	["GWAS catalog (Clear cell renal cell carcinoma)","GWAS catalog (Kidney cancer)"]
SRBD1	2	["Glaucoma","Hemorrhoid"]	0	[]	2	["GWAS catalog (Glaucoma)","GWAS catalog (Hemorrhoid)"]
SFMBT1	3	["Clear cell renal cell carcinoma","Hemorrhoid","Kidney cancer"]	0	[]	3	["GWAS catalog (Clear cell renal cell carcinoma)","GWAS catalog (Hemorrhoid)","GWAS catalog (Kidney cancer)"]
DPF3	2	["Clear cell renal cell carcinoma","Kidney cancer"]	0	[]	2	["GWAS catalog (Clear cell renal cell carcinoma)","GWAS catalog (Kidney cancer)"]
DCAF12L1	2	["Clear cell renal cell carcinoma","Kidney cancer"]	0	[]	2	["GWAS catalog (Clear cell renal cell carcinoma)","GWAS catalog (Kidney cancer)"]

Diseases Linked via Similar Genes

Kidney disease Linked via 2 of 5 related genesSFMBT1, DPF3 Major depressive disorder Linked via 2 of 5 related genesSFMBT1, DPF3 Alzheimer disease Linked via 1 of 5 related genesSRBD1 Squamous cell carcinoma Linked via 1 of 5 related genesSRBD1 Colorectal cancer Linked via 1 of 5 related genesSFMBT1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Kidney disease	2	["SFMBT1","DPF3"]
Major depressive disorder	2	["SFMBT1","DPF3"]
Alzheimer disease	1	["SRBD1"]
Squamous cell carcinoma	1	["SRBD1"]
Colorectal cancer	1	["SFMBT1"]