RHOG (ras homolog family member G)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 391
• Gene name: Ras homolog family member G
• Gene symbol: RHOG
• Synonyms (NCBI Gene): ARHG
• Chromosome: 11
• Chromosome location: 11p15.4
• Summary: This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskel

miRNA Show/Hide all (160)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001598	hsa-let-7b-5p	pSILAC	18668040
MIRT002922	hsa-miR-124-3p	Luciferase reporter assay	22085528
MIRT002922	hsa-miR-124-3p	Luciferase reporter assay	22085528
MIRT002922	hsa-miR-124-3p	Luciferase reporter assay	22085528
MIRT002922	hsa-miR-124-3p	Luciferase reporter assay	22085528
MIRT002922	hsa-miR-124-3p	Luciferase reporter assay	22085528
MIRT002922	hsa-miR-124-3p	Luciferase reporter assay	22085528
MIRT002922	hsa-miR-124-3p	Microarray	18668037
MIRT001598	hsa-let-7b-5p	Proteomics;Other	18668040
MIRT693806	hsa-miR-892a	HITS-CLIP	23313552
MIRT693805	hsa-miR-1910-3p	HITS-CLIP	23313552
MIRT693804	hsa-miR-6511a-5p	HITS-CLIP	23313552
MIRT693803	hsa-miR-6808-5p	HITS-CLIP	23313552
MIRT693802	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT693801	hsa-miR-940	HITS-CLIP	23313552
MIRT693800	hsa-miR-2682-5p	HITS-CLIP	23313552
MIRT693799	hsa-miR-34b-5p	HITS-CLIP	23313552
MIRT693798	hsa-miR-449c-5p	HITS-CLIP	23313552
MIRT693797	hsa-miR-6826-5p	HITS-CLIP	23313552
MIRT693796	hsa-miR-3911	HITS-CLIP	23313552
MIRT693795	hsa-miR-644a	HITS-CLIP	23313552
MIRT693794	hsa-miR-147a	HITS-CLIP	23313552
MIRT646728	hsa-miR-6769a-3p	HITS-CLIP	23824327
MIRT646727	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT646726	hsa-miR-6728-3p	HITS-CLIP	23824327
MIRT646725	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT646724	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT646723	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT646722	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT646721	hsa-miR-216b-5p	HITS-CLIP	23824327
MIRT726743	hsa-miR-181a-5p	HITS-CLIP	22473208
MIRT726742	hsa-miR-181b-5p	HITS-CLIP	22473208
MIRT726740	hsa-miR-181c-5p	HITS-CLIP	22473208
MIRT726741	hsa-miR-181d-5p	HITS-CLIP	22473208
MIRT002922	hsa-miR-124-3p	Luciferase reporter assay, Western blot	26746014
MIRT002922	hsa-miR-124-3p	Luciferase reporter assay, Western blot	26746014
MIRT002922	hsa-miR-124-3p	Luciferase reporter assay, Western blot	26746014
MIRT002922	hsa-miR-124-3p	Luciferase reporter assay, Western blot	26746014
MIRT002922	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blotting	33649803
MIRT693806	hsa-miR-892a	HITS-CLIP	23313552
MIRT693805	hsa-miR-1910-3p	HITS-CLIP	23313552
MIRT693804	hsa-miR-6511a-5p	HITS-CLIP	23313552
MIRT693803	hsa-miR-6808-5p	HITS-CLIP	23313552
MIRT693802	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT693801	hsa-miR-940	HITS-CLIP	23313552
MIRT693800	hsa-miR-2682-5p	HITS-CLIP	23313552
MIRT693799	hsa-miR-34b-5p	HITS-CLIP	23313552
MIRT693798	hsa-miR-449c-5p	HITS-CLIP	23313552
MIRT693797	hsa-miR-6826-5p	HITS-CLIP	23313552
MIRT693796	hsa-miR-3911	HITS-CLIP	23313552
MIRT693795	hsa-miR-644a	HITS-CLIP	23313552
MIRT693794	hsa-miR-147a	HITS-CLIP	23313552
MIRT646728	hsa-miR-6769a-3p	HITS-CLIP	23824327
MIRT646727	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT646726	hsa-miR-6728-3p	HITS-CLIP	23824327
MIRT646725	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT646724	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT646723	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT646722	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT646721	hsa-miR-216b-5p	HITS-CLIP	23824327
MIRT1305942	hsa-miR-1207-5p	CLIP-seq
MIRT1305943	hsa-miR-1255a	CLIP-seq
MIRT1305944	hsa-miR-1255b	CLIP-seq
MIRT1305945	hsa-miR-1287	CLIP-seq
MIRT1305946	hsa-miR-147	CLIP-seq
MIRT1305947	hsa-miR-1909	CLIP-seq
MIRT1305948	hsa-miR-199a-3p	CLIP-seq
MIRT1305949	hsa-miR-199b-3p	CLIP-seq
MIRT1305950	hsa-miR-2682	CLIP-seq
MIRT1305951	hsa-miR-3129-5p	CLIP-seq
MIRT1305952	hsa-miR-3190	CLIP-seq
MIRT1305953	hsa-miR-320a	CLIP-seq
MIRT1305954	hsa-miR-320b	CLIP-seq
MIRT1305955	hsa-miR-320c	CLIP-seq
MIRT1305956	hsa-miR-320d	CLIP-seq
MIRT1305957	hsa-miR-320e	CLIP-seq
MIRT1305958	hsa-miR-3545-3p	CLIP-seq
MIRT1305959	hsa-miR-3616-3p	CLIP-seq
MIRT1305960	hsa-miR-3978	CLIP-seq
MIRT1305961	hsa-miR-4429	CLIP-seq
MIRT1305962	hsa-miR-4447	CLIP-seq
MIRT1305963	hsa-miR-4456	CLIP-seq
MIRT1305964	hsa-miR-4472	CLIP-seq
MIRT1305965	hsa-miR-4488	CLIP-seq
MIRT1305966	hsa-miR-449c	CLIP-seq
MIRT1305967	hsa-miR-4656	CLIP-seq
MIRT1305968	hsa-miR-4688	CLIP-seq
MIRT1305969	hsa-miR-4697-5p	CLIP-seq
MIRT1305970	hsa-miR-4704-3p	CLIP-seq
MIRT1305971	hsa-miR-4723-5p	CLIP-seq
MIRT1305972	hsa-miR-4728-5p	CLIP-seq
MIRT1305973	hsa-miR-4763-3p	CLIP-seq
MIRT1305974	hsa-miR-541	CLIP-seq
MIRT1305975	hsa-miR-545	CLIP-seq
MIRT1305976	hsa-miR-582-3p	CLIP-seq
MIRT1305977	hsa-miR-644	CLIP-seq
MIRT1305978	hsa-miR-654-5p	CLIP-seq
MIRT1305979	hsa-miR-936	CLIP-seq
MIRT1305942	hsa-miR-1207-5p	CLIP-seq
MIRT2090628	hsa-miR-124	CLIP-seq
MIRT1305947	hsa-miR-1909	CLIP-seq
MIRT2090629	hsa-miR-3197	CLIP-seq
MIRT1305959	hsa-miR-3616-3p	CLIP-seq
MIRT1305962	hsa-miR-4447	CLIP-seq
MIRT1305964	hsa-miR-4472	CLIP-seq
MIRT1305968	hsa-miR-4688	CLIP-seq
MIRT1305971	hsa-miR-4723-5p	CLIP-seq
MIRT1305972	hsa-miR-4728-5p	CLIP-seq
MIRT1305973	hsa-miR-4763-3p	CLIP-seq
MIRT2090630	hsa-miR-486-3p	CLIP-seq
MIRT2090631	hsa-miR-506	CLIP-seq
MIRT1305974	hsa-miR-541	CLIP-seq
MIRT1305976	hsa-miR-582-3p	CLIP-seq
MIRT1305978	hsa-miR-654-5p	CLIP-seq
MIRT2315292	hsa-miR-105	CLIP-seq
MIRT2090628	hsa-miR-124	CLIP-seq
MIRT1305943	hsa-miR-1255a	CLIP-seq
MIRT1305944	hsa-miR-1255b	CLIP-seq
MIRT1305945	hsa-miR-1287	CLIP-seq
MIRT2315293	hsa-miR-1296	CLIP-seq
MIRT1305946	hsa-miR-147	CLIP-seq
MIRT2315294	hsa-miR-181a	CLIP-seq
MIRT2315295	hsa-miR-181b	CLIP-seq
MIRT2315296	hsa-miR-181c	CLIP-seq
MIRT2315297	hsa-miR-181d	CLIP-seq
MIRT1305948	hsa-miR-199a-3p	CLIP-seq
MIRT1305949	hsa-miR-199b-3p	CLIP-seq
MIRT1305950	hsa-miR-2682	CLIP-seq
MIRT1305951	hsa-miR-3129-5p	CLIP-seq
MIRT2315298	hsa-miR-3135	CLIP-seq
MIRT1305952	hsa-miR-3190	CLIP-seq
MIRT2090629	hsa-miR-3197	CLIP-seq
MIRT1305953	hsa-miR-320a	CLIP-seq
MIRT1305954	hsa-miR-320b	CLIP-seq
MIRT1305955	hsa-miR-320c	CLIP-seq
MIRT1305956	hsa-miR-320d	CLIP-seq
MIRT1305957	hsa-miR-320e	CLIP-seq
MIRT1305958	hsa-miR-3545-3p	CLIP-seq
MIRT2315299	hsa-miR-3689a-3p	CLIP-seq
MIRT2315300	hsa-miR-3689c	CLIP-seq
MIRT1305960	hsa-miR-3978	CLIP-seq
MIRT2315301	hsa-miR-4262	CLIP-seq
MIRT1305961	hsa-miR-4429	CLIP-seq
MIRT1305966	hsa-miR-449c	CLIP-seq
MIRT1305972	hsa-miR-4728-5p	CLIP-seq
MIRT2315302	hsa-miR-4753-5p	CLIP-seq
MIRT2090631	hsa-miR-506	CLIP-seq
MIRT1305975	hsa-miR-545	CLIP-seq
MIRT1305976	hsa-miR-582-3p	CLIP-seq
MIRT1305977	hsa-miR-644	CLIP-seq
MIRT1305979	hsa-miR-936	CLIP-seq
MIRT2442558	hsa-miR-1266	CLIP-seq
MIRT2315293	hsa-miR-1296	CLIP-seq
MIRT2315294	hsa-miR-181a	CLIP-seq
MIRT2315295	hsa-miR-181b	CLIP-seq
MIRT2315296	hsa-miR-181c	CLIP-seq
MIRT2315297	hsa-miR-181d	CLIP-seq
MIRT2442559	hsa-miR-3664-3p	CLIP-seq
MIRT2315301	hsa-miR-4262	CLIP-seq
MIRT2442560	hsa-miR-4518	CLIP-seq

Gene ontology (GO) Show/Hide all (45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IDA	12376551
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS	1620121
GO:0005515	Function	Protein binding	IPI	12879077, 20679435, 33513601
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007015	Process	Actin filament organization	IBA
GO:0007163	Process	Establishment or maintenance of cell polarity	IBA
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0007266	Process	Rho protein signal transduction	IDA	12376551
GO:0007266	Process	Rho protein signal transduction	TAS	1620121
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	1620121
GO:0008360	Process	Regulation of cell shape	IBA
GO:0016020	Component	Membrane	IEA
GO:0016601	Process	Rac protein signal transduction	IBA
GO:0016601	Process	Rac protein signal transduction	IDA	12376551
GO:0019901	Function	Protein kinase binding	IBA
GO:0030036	Process	Actin cytoskeleton organization	IDA	12545154
GO:0030667	Component	Secretory granule membrane	TAS
GO:0030865	Process	Cortical cytoskeleton organization	IBA
GO:0031410	Component	Cytoplasmic vesicle	IBA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IBA
GO:0042995	Component	Cell projection	IBA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	12545154
GO:0060326	Process	Cell chemotaxis	IBA
GO:0060326	Process	Cell chemotaxis	IMP	20679435
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0090630	Process	Activation of GTPase activity	IMP	20679435
GO:0098794	Component	Postsynapse	IDA	21900250
GO:0098794	Component	Postsynapse	IMP	21900250
GO:0098978	Component	Glutamatergic synapse	IDA	21900250
GO:0098978	Component	Glutamatergic synapse	IMP	21900250
GO:0150052	Process	Regulation of postsynapse assembly	IDA	21900250
GO:0150052	Process	Regulation of postsynapse assembly	IMP	21900250
GO:1900027	Process	Regulation of ruffle assembly	IEA
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IMP	20679435

Other IDs

• MIM: 179505
• HGNC: 672
• e!Ensembl: ENSG00000177105

Protein

• UniProt ID: P84095
• Protein name: Rho-related GTP-binding protein RhoG
• Protein function: Plays a role in immunological synaptic F-actin density and architecture organization (PubMed:33513601). Regulates actin reorganization in lymphocytes, possibly through the modulation of Rac1 activity (PubMed:33513601). Required for the formation
• PDB: 6UKA , 7Y4A , 8XM7 , 8ZJ2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00071	Ras	5 → 178	Ras family	Domain

• Sequence:

  MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAG
  QEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLR
  AQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPT
  PIKRGRSCILL

• Sequence length: 191

Pathways

KEGG Pathway	Reactome Pathway
Bacterial invasion of epithelial cells	GPVI-mediated activation cascade
Salmonella infection	PIP3 activates AKT signaling
Yersinia infection	Rho GTPase cycle
	Constitutive Signaling by Aberrant PI3K in Cancer
	RHO GTPases activate KTN1
	Neutrophil degranulation
	PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	40050429	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	34506852	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
hemophagocytic lymphohistiocytosis due to RhoG deficiency	—	ClinGen	33513601, 4701744, ClinGen report	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (13)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	26231656, 27216196, 28202690, 29101386	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24443565	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	27832197	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30599132	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30423016		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23775076	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	30212930	Associate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	33513601	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27691842, 30781697		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	27662902, 28949383		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	28949383	Stimulate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	32963317	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28248929	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

TRAT1 3 shared pathwaysPIP3 activates AKT signaling, Constitutive Signaling by Aberrant PI3K in Cancer, PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling Related via 3 shared pathways including PIP3 activates AKT signaling, Constitutive Signaling by Aberrant PI3K in Cancer. ARHGEF26 3 shared pathwaysBacterial invasion of epithelial cells, Salmonella infection, Rho GTPase cycle Related via 3 shared pathways including Bacterial invasion of epithelial cells, Salmonella infection. PIK3AP1 3 shared pathwaysPIP3 activates AKT signaling, Constitutive Signaling by Aberrant PI3K in Cancer, PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling Related via 3 shared pathways including PIP3 activates AKT signaling, Constitutive Signaling by Aberrant PI3K in Cancer. STRN 3 shared pathwaysPIP3 activates AKT signaling, Constitutive Signaling by Aberrant PI3K in Cancer, PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling Related via 3 shared pathways including PIP3 activates AKT signaling, Constitutive Signaling by Aberrant PI3K in Cancer. ARHGAP10 2 shared pathwaysBacterial invasion of epithelial cells, Rho GTPase cycle Related via 2 shared pathways including Bacterial invasion of epithelial cells, Rho GTPase cycle.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
TRAT1	0	[]	3	["PIP3 activates AKT signaling","Constitutive Signaling by Aberrant PI3K in Cancer","PI5P, PP2A and IER3 Regulate PI3K\/AKT Signaling"]	0	[]
ARHGEF26	0	[]	3	["Bacterial invasion of epithelial cells","Salmonella infection","Rho GTPase cycle"]	0	[]
PIK3AP1	0	[]	3	["PIP3 activates AKT signaling","Constitutive Signaling by Aberrant PI3K in Cancer","PI5P, PP2A and IER3 Regulate PI3K\/AKT Signaling"]	0	[]
STRN	0	[]	3	["PIP3 activates AKT signaling","Constitutive Signaling by Aberrant PI3K in Cancer","PI5P, PP2A and IER3 Regulate PI3K\/AKT Signaling"]	0	[]
ARHGAP10	0	[]	2	["Bacterial invasion of epithelial cells","Rho GTPase cycle"]	0	[]

Diseases Linked via Similar Genes

Hypertension Linked via 2 of 5 related genesTRAT1, ARHGAP10 Colorectal cancer Linked via 2 of 5 related genesARHGEF26, ARHGAP10 Schizophrenia Linked via 2 of 5 related genesARHGEF26, STRN Autoimmune thyroid disease Linked via 1 of 5 related genesTRAT1 Hypothyroidism Linked via 1 of 5 related genesTRAT1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Hypertension	2	["TRAT1","ARHGAP10"]
Colorectal cancer	2	["ARHGEF26","ARHGAP10"]
Schizophrenia	2	["ARHGEF26","STRN"]
Autoimmune thyroid disease	1	["TRAT1"]
Hypothyroidism	1	["TRAT1"]