Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	79658
Gene name	Rho GTPase activating protein 10
Gene symbol	ARHGAP10
Synonyms (NCBI Gene)	GRAF2PS-GAPPSGAP
Chromosome	4
Chromosome location	4q31.23

118 Show/Hide all (118)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051013	hsa-miR-17-5p	CLASH	23622248
MIRT437670	hsa-miR-214-3p	MicroarrayqRT-PCR	22815788
MIRT793542	hsa-miR-128	CLIP-seq
MIRT793543	hsa-miR-27a	CLIP-seq
MIRT793544	hsa-miR-27b	CLIP-seq
MIRT793545	hsa-miR-3064-3p	CLIP-seq
MIRT793546	hsa-miR-4277	CLIP-seq
MIRT793547	hsa-miR-4667-3p	CLIP-seq
MIRT793548	hsa-miR-4705	CLIP-seq
MIRT793549	hsa-miR-603	CLIP-seq
MIRT793550	hsa-miR-640	CLIP-seq
MIRT1934153	hsa-miR-1915	CLIP-seq
MIRT793545	hsa-miR-3064-3p	CLIP-seq
MIRT1934154	hsa-miR-361-3p	CLIP-seq
MIRT1934155	hsa-miR-3665	CLIP-seq
MIRT1934156	hsa-miR-3929	CLIP-seq
MIRT1934157	hsa-miR-4419b	CLIP-seq
MIRT1934158	hsa-miR-4478	CLIP-seq
MIRT793549	hsa-miR-603	CLIP-seq
MIRT1934159	hsa-miR-623	CLIP-seq
MIRT1934160	hsa-miR-645	CLIP-seq
MIRT1934161	hsa-miR-765	CLIP-seq
MIRT2174019	hsa-miR-1304	CLIP-seq
MIRT2174020	hsa-miR-1827	CLIP-seq
MIRT2174021	hsa-miR-2276	CLIP-seq
MIRT793545	hsa-miR-3064-3p	CLIP-seq
MIRT2174022	hsa-miR-3148	CLIP-seq
MIRT2174023	hsa-miR-3150b-3p	CLIP-seq
MIRT2174024	hsa-miR-34c-3p	CLIP-seq
MIRT2174025	hsa-miR-3978	CLIP-seq
MIRT2174026	hsa-miR-4694-5p	CLIP-seq
MIRT2174027	hsa-miR-4772-3p	CLIP-seq
MIRT2174028	hsa-miR-4784	CLIP-seq
MIRT2174029	hsa-miR-570	CLIP-seq
MIRT2174030	hsa-miR-602	CLIP-seq
MIRT793549	hsa-miR-603	CLIP-seq
MIRT2477606	hsa-miR-1261	CLIP-seq
MIRT2477607	hsa-miR-1266	CLIP-seq
MIRT2477608	hsa-miR-1273	CLIP-seq
MIRT2477609	hsa-miR-1287	CLIP-seq
MIRT2477610	hsa-miR-1321	CLIP-seq
MIRT2477611	hsa-miR-15a	CLIP-seq
MIRT2477612	hsa-miR-15b	CLIP-seq
MIRT2477613	hsa-miR-16	CLIP-seq
MIRT2477614	hsa-miR-195	CLIP-seq
MIRT2477615	hsa-miR-204	CLIP-seq
MIRT2477616	hsa-miR-211	CLIP-seq
MIRT2477617	hsa-miR-214	CLIP-seq
MIRT2174021	hsa-miR-2276	CLIP-seq
MIRT2477618	hsa-miR-298	CLIP-seq
MIRT793545	hsa-miR-3064-3p	CLIP-seq
MIRT2477619	hsa-miR-3135b	CLIP-seq
MIRT2174023	hsa-miR-3150b-3p	CLIP-seq
MIRT2174024	hsa-miR-34c-3p	CLIP-seq
MIRT2477620	hsa-miR-3612	CLIP-seq
MIRT2477621	hsa-miR-3619-5p	CLIP-seq
MIRT1934155	hsa-miR-3665	CLIP-seq
MIRT2477622	hsa-miR-3907	CLIP-seq
MIRT2477623	hsa-miR-424	CLIP-seq
MIRT2477624	hsa-miR-4270	CLIP-seq
MIRT2477625	hsa-miR-4290	CLIP-seq
MIRT2477626	hsa-miR-4441	CLIP-seq
MIRT2477627	hsa-miR-4443	CLIP-seq
MIRT2477628	hsa-miR-4469	CLIP-seq
MIRT2477629	hsa-miR-4518	CLIP-seq
MIRT2477630	hsa-miR-4668-3p	CLIP-seq
MIRT2477631	hsa-miR-4728-3p	CLIP-seq
MIRT2477632	hsa-miR-4739	CLIP-seq
MIRT2477633	hsa-miR-4755-5p	CLIP-seq
MIRT2477634	hsa-miR-4756-5p	CLIP-seq
MIRT2174027	hsa-miR-4772-3p	CLIP-seq
MIRT2174028	hsa-miR-4784	CLIP-seq
MIRT2477635	hsa-miR-497	CLIP-seq
MIRT2477636	hsa-miR-552	CLIP-seq
MIRT2477637	hsa-miR-582-5p	CLIP-seq
MIRT793549	hsa-miR-603	CLIP-seq
MIRT1934159	hsa-miR-623	CLIP-seq
MIRT2477638	hsa-miR-642a	CLIP-seq
MIRT2477639	hsa-miR-650	CLIP-seq
MIRT2477640	hsa-miR-761	CLIP-seq
MIRT2477641	hsa-miR-764	CLIP-seq
MIRT1934161	hsa-miR-765	CLIP-seq
MIRT2477606	hsa-miR-1261	CLIP-seq
MIRT2477608	hsa-miR-1273	CLIP-seq
MIRT793542	hsa-miR-128	CLIP-seq
MIRT2477609	hsa-miR-1287	CLIP-seq
MIRT2675254	hsa-miR-147	CLIP-seq
MIRT2477615	hsa-miR-204	CLIP-seq
MIRT2477616	hsa-miR-211	CLIP-seq
MIRT2174021	hsa-miR-2276	CLIP-seq
MIRT793543	hsa-miR-27a	CLIP-seq
MIRT793544	hsa-miR-27b	CLIP-seq
MIRT2477618	hsa-miR-298	CLIP-seq
MIRT793545	hsa-miR-3064-3p	CLIP-seq
MIRT2477619	hsa-miR-3135b	CLIP-seq
MIRT2174024	hsa-miR-34c-3p	CLIP-seq
MIRT2477620	hsa-miR-3612	CLIP-seq
MIRT2675255	hsa-miR-3911	CLIP-seq
MIRT793546	hsa-miR-4277	CLIP-seq
MIRT2477625	hsa-miR-4290	CLIP-seq
MIRT2477627	hsa-miR-4443	CLIP-seq
MIRT2675256	hsa-miR-4466	CLIP-seq
MIRT2477628	hsa-miR-4469	CLIP-seq
MIRT793547	hsa-miR-4667-3p	CLIP-seq
MIRT2477630	hsa-miR-4668-3p	CLIP-seq
MIRT793548	hsa-miR-4705	CLIP-seq
MIRT2477631	hsa-miR-4728-3p	CLIP-seq
MIRT2477633	hsa-miR-4755-5p	CLIP-seq
MIRT2174027	hsa-miR-4772-3p	CLIP-seq
MIRT2477636	hsa-miR-552	CLIP-seq
MIRT2477637	hsa-miR-582-5p	CLIP-seq
MIRT793549	hsa-miR-603	CLIP-seq
MIRT1934159	hsa-miR-623	CLIP-seq
MIRT793550	hsa-miR-640	CLIP-seq
MIRT2477638	hsa-miR-642a	CLIP-seq
MIRT2675257	hsa-miR-644	CLIP-seq
MIRT2477639	hsa-miR-650	CLIP-seq
MIRT2675258	hsa-miR-675	CLIP-seq

21 Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	TAS
GO:0005515	Function	Protein binding	IPI	11432776, 32344433, 32707033
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	32344433
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0007010	Process	Cytoskeleton organization	IBA
GO:0007010	Process	Cytoskeleton organization	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0010008	Component	Endosome membrane	IDA	32344433
GO:0010008	Component	Endosome membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS

MIM	HGNC	e!Ensembl
609746	26099	ENSG00000071205

A1A4S6

Protein name

Rho GTPase-activating protein 10 (GTPase regulator associated with focal adhesion kinase 2) (GRAF2) (Graf-related protein 2) (Rho-type GTPase-activating protein 10)

Protein function

GTPase-activating protein that catalyzes the conversion of active GTP-bound Rho GTPases to their inactive GDP-bound form, thus suppressing various Rho GTPase-mediated cellular processes (PubMed:11432776). Also converts Cdc42 to an inactive GDP-b

PDB

2MIO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00169	PH	266 → 369	PH domain	Domain
PF00620	RhoGAP	397 → 551	RhoGAP domain	Domain
PF14604	SH3_9	735 → 784	Variant SH3 domain	Domain
PF16746	BAR_3	6 → 249		Domain

Tissue specificity

TISSUE SPECIFICITY: High levels of expression in heart and skeletal muscle. {ECO:0000269|PubMed:11432776}.

Sequence

MGLQPLEFSDCYLDSPWFRERIRAHEAELERTNKFIKELIKDGKNLIAATKSLSVAQRKF
AHSLRDFKFEFIGDAVTDDERCIDASLREFSNFLKNLEEQREIMALSVTETLIKPLEKFR
KEQLGAVKEEKKKFDKETEKNYSLIDKHLNLSAKKKDSHLQEADIQVEQNRQHFYELSLE
YVCKLQEIQERKKFEFVEPMLSFFQGMFTFYHQGHELAKDFNHYKMELQINIQNTRNRFE
GTRSEVEELMNKIRQNPKDHKRASQFTAEGYLYVQEKRPAPFGSSWVKHYCMYRKAAKKF
NMIPFEHRSGGKLGDGEVFFLKECTKRHTDSIDRRFCFDIEAADRPGVSLTMQAFSEEER
KQWLEALGGKEALSHSFNTAIIPRPEGNAQLDKMGFTIIRKCISAVETRGINDQGLYRVV
GVSSKVQRLLSMLMDVKTCNEVDLENSADWEVKTITSALKQYLRSLPEPLMTYELHGDFI
VPAKSGSPESRVNAIHFLVHKLPEKNKEMLDILVKHLTNVSNHSKQNLMTVANLGVVFGP
TLMRPQEETVAALMDLKFQNIVVEILIENHEKIFRTPPDTTFPEPTCLSASPPNAPPRQS
KRQGQRTKRPVAVYNLCLELEDGDNPYPSKEDTPTSSLDSLSSPSPVTTAVPGPPGPDKN
HLLADGGSFGDWASTIPGQTRSSMVQWLNPQSPTTTSSNSAVTPLSPGSSPFPFSPPATV
ADKPPESIRSRKARAVYPCEAEHSSELSFEIGAIFEDVQTSREPGWLEGTLNGKRGLIPQ
NYVKLL

Sequence length

786

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Bacterial invasion of epithelial cells	Rho GTPase cycle

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (19)
Acute myeloid leukemia	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	29892015, 29892015, 30061737, 30061737, 35872910, 36653681, 39024449, 39537608, 40050429, 40645996	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FLUTTER	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	38411962	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPIDERMOLYSIS BULLOSA SIMPLEX 5D, GENERALIZED INTERMEDIATE, AUTOSOMAL RECESSIVE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epidermolysis bullosa simplex with nail dystrophy	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEROPIA	—	GWAS catalog	33830181	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	38965376	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	30804565	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (17)
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	29892015, 30061737		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	29892015, 30061737		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases of the Nervous System	Autoimmune nervous system disorder	Pubtator	35624318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20332263, 31396458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28943961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27010858, 31445707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	35624318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20332263, 31396458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28943961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27010858, 31445707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27010858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27010858, 28943961, 31445707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31561126		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27010858, 31445707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	29892015, 30061737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	35624318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	35624318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ARHGAP10 (Rho GTPase activating protein 10)

Bookmark This Gene