RHNO1 (RAD9-HUS1-RAD1 interacting nuclear orphan 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 83695
Gene name RAD9-HUS1-RAD1 interacting nuclear orphan 1
Gene symbol RHNO1
Synonyms (NCBI Gene)
C12orf32HKMT1188RHINO
Chromosome 12
Chromosome location 12p13.33
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
26 Show/Hide all (26)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000077 Process DNA damage checkpoint signaling IBA
GO:0000077 Process DNA damage checkpoint signaling IDA 25602520
GO:0000077 Process DNA damage checkpoint signaling IEA
GO:0000077 Process DNA damage checkpoint signaling IMP 21659603
GO:0000725 Process Recombinational repair IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
614085 28206 ENSG00000171792
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BSD3
Protein name RAD9, HUS1, RAD1-interacting nuclear orphan protein 1 (RAD9, RAD1, HUS1-interacting nuclear orphan protein)
Protein function Involved in microhomology-mediated end-joining (MMEJ) DNA repair by promoting recruitment of polymerase theta (POLQ) to DNA damage sites during mitosis (PubMed:37440612). MMEJ is an alternative non-homologous end-joining (NHEJ) machinery that ta
PDB 6J8Y , 8WU8
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15319 RHINO 1 → 236 RAD9, RAD1, HUS1-interacting nuclear orphan protein Family
Tissue specificity TISSUE SPECIFICITY: Weakly expressed in testis, prostate, ovary, thymus and small intestine (PubMed:20811708). Expressed strongly in breast cancer cells (PubMed:20811708). {ECO:0000269|PubMed:20811708}.
Sequence 
MPPRKKRRQPSQKAPLLFHQQPLEGPKHSCASTQLPITHTRQVPSKPIDHSTITSWVSPD
FDTAAGSLFPAYQKHQNRARHSSRKPTTSKFPHLTFESPQSSSSETLGIPLIRECPSESE
KDVSRRPLVPVLSPQSCGNMSVQALQSLPYVFIPPDIQTPESSSVKEELIPQDQKENSLL
SCTLHTGTPNSPEPGPVLVKDTPEDKYGIKVTWRRRQHLLAYLRERGKLSRSQFLVKS
Sequence length 238
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
HDR through Single Strand Annealing (SSA)
Processing of DNA double-strand break ends
Presynaptic phase of homologous DNA pairing and strand exchange
Regulation of TP53 Activity through Phosphorylation
G2/M DNA damage checkpoint
Sort by:
TOPBP1 5 shared pathwaysHDR through Single Strand Annealing (SSA), Processing of DNA double-strand break ends, Presynaptic phase of homologous DNA pairing and strand exchange, Regulation of TP53 Activity through Phosphorylation, G2/M DNA damage checkpoint Related via 5 shared pathways including HDR through Single Strand Annealing (SSA), Processing of DNA double-strand break ends. RAD17 5 shared pathwaysHDR through Single Strand Annealing (SSA), Processing of DNA double-strand break ends, Presynaptic phase of homologous DNA pairing and strand exchange, Regulation of TP53 Activity through Phosphorylation, G2/M DNA damage checkpoint Related via 5 shared pathways including HDR through Single Strand Annealing (SSA), Processing of DNA double-strand break ends. RAD9B 5 shared pathwaysHDR through Single Strand Annealing (SSA), Processing of DNA double-strand break ends, Presynaptic phase of homologous DNA pairing and strand exchange, Regulation of TP53 Activity through Phosphorylation, G2/M DNA damage checkpoint Related via 5 shared pathways including HDR through Single Strand Annealing (SSA), Processing of DNA double-strand break ends. HUS1 5 shared pathwaysHDR through Single Strand Annealing (SSA), Processing of DNA double-strand break ends, Presynaptic phase of homologous DNA pairing and strand exchange, Regulation of TP53 Activity through Phosphorylation, G2/M DNA damage checkpoint Related via 5 shared pathways including HDR through Single Strand Annealing (SSA), Processing of DNA double-strand break ends. RAD1 5 shared pathwaysHDR through Single Strand Annealing (SSA), Processing of DNA double-strand break ends, Presynaptic phase of homologous DNA pairing and strand exchange, Regulation of TP53 Activity through Phosphorylation, G2/M DNA damage checkpoint Related via 5 shared pathways including HDR through Single Strand Annealing (SSA), Processing of DNA double-strand break ends.
Lymphocytic b-cell leukemia Linked via 1 of 5 related genesTOPBP1 Oligodendroglioma Linked via 1 of 5 related genesTOPBP1 Pulmonary arterial hypertension Linked via 1 of 5 related genesTOPBP1 Multiple sclerosis Linked via 1 of 5 related genesRAD17 Neural tube defect Linked via 1 of 5 related genesRAD9B