HUS1 (HUS1 checkpoint clamp component)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 3364
• Gene name: HUS1 checkpoint clamp component
• Gene symbol: HUS1
• Synonyms (NCBI Gene): hHUS1
• Chromosome: 7
• Chromosome location: 7p12.3
• Summary: The protein encoded by this gene is a component of an evolutionarily conserved, genotoxin-activated checkpoint complex that is involved in the cell cycle arrest in response to DNA damage. This protein forms a heterotrimeric complex with checkpoint protein

miRNA Show/Hide all (384)

miRTarBase ID	miRNA	Experiments	Reference
MIRT047873	hsa-miR-30c-5p	CLASH	23622248
MIRT679594	hsa-miR-4761-5p	HITS-CLIP	23824327
MIRT679593	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT679592	hsa-miR-4284	HITS-CLIP	23824327
MIRT679591	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT679590	hsa-miR-6769a-5p	HITS-CLIP	23824327
MIRT679589	hsa-miR-6769b-5p	HITS-CLIP	23824327
MIRT679588	hsa-miR-6748-5p	HITS-CLIP	23824327
MIRT679587	hsa-miR-7977	HITS-CLIP	23824327
MIRT679586	hsa-miR-6821-5p	HITS-CLIP	23824327
MIRT664853	hsa-miR-6808-5p	HITS-CLIP	23824327
MIRT664852	hsa-miR-6893-5p	HITS-CLIP	23824327
MIRT664851	hsa-miR-940	HITS-CLIP	23824327
MIRT664850	hsa-miR-3929	HITS-CLIP	23824327
MIRT664849	hsa-miR-4419b	HITS-CLIP	23824327
MIRT664848	hsa-miR-4478	HITS-CLIP	23824327
MIRT664847	hsa-miR-4768-3p	HITS-CLIP	23824327
MIRT664846	hsa-miR-4649-3p	HITS-CLIP	23824327
MIRT664845	hsa-miR-1827	HITS-CLIP	23824327
MIRT664844	hsa-miR-485-5p	HITS-CLIP	23824327
MIRT664843	hsa-miR-6884-5p	HITS-CLIP	23824327
MIRT664842	hsa-miR-4722-5p	HITS-CLIP	23824327
MIRT664841	hsa-miR-7160-5p	HITS-CLIP	23824327
MIRT664840	hsa-miR-4747-5p	HITS-CLIP	23824327
MIRT664839	hsa-miR-5196-5p	HITS-CLIP	23824327
MIRT664838	hsa-miR-7158-3p	HITS-CLIP	23824327
MIRT664837	hsa-miR-203b-3p	HITS-CLIP	23824327
MIRT664836	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT664835	hsa-miR-665	HITS-CLIP	23824327
MIRT735521	hsa-miR-190b	Luciferase reporter assay, Western blotting, qRT-PCR	33137086
MIRT679594	hsa-miR-4761-5p	HITS-CLIP	23824327
MIRT679593	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT679592	hsa-miR-4284	HITS-CLIP	23824327
MIRT679591	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT679590	hsa-miR-6769a-5p	HITS-CLIP	23824327
MIRT679589	hsa-miR-6769b-5p	HITS-CLIP	23824327
MIRT679588	hsa-miR-6748-5p	HITS-CLIP	23824327
MIRT679587	hsa-miR-7977	HITS-CLIP	23824327
MIRT679586	hsa-miR-6821-5p	HITS-CLIP	23824327
MIRT664853	hsa-miR-6808-5p	HITS-CLIP	23824327
MIRT664852	hsa-miR-6893-5p	HITS-CLIP	23824327
MIRT664851	hsa-miR-940	HITS-CLIP	23824327
MIRT664850	hsa-miR-3929	HITS-CLIP	23824327
MIRT664849	hsa-miR-4419b	HITS-CLIP	23824327
MIRT664848	hsa-miR-4478	HITS-CLIP	23824327
MIRT664847	hsa-miR-4768-3p	HITS-CLIP	23824327
MIRT664846	hsa-miR-4649-3p	HITS-CLIP	23824327
MIRT664845	hsa-miR-1827	HITS-CLIP	23824327
MIRT664844	hsa-miR-485-5p	HITS-CLIP	23824327
MIRT664843	hsa-miR-6884-5p	HITS-CLIP	23824327
MIRT664842	hsa-miR-4722-5p	HITS-CLIP	23824327
MIRT664841	hsa-miR-7160-5p	HITS-CLIP	23824327
MIRT664840	hsa-miR-4747-5p	HITS-CLIP	23824327
MIRT664839	hsa-miR-5196-5p	HITS-CLIP	23824327
MIRT664838	hsa-miR-7158-3p	HITS-CLIP	23824327
MIRT664837	hsa-miR-203b-3p	HITS-CLIP	23824327
MIRT664836	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT664835	hsa-miR-665	HITS-CLIP	23824327
MIRT1057624	hsa-miR-1254	CLIP-seq
MIRT1057625	hsa-miR-1262	CLIP-seq
MIRT1057626	hsa-miR-1268	CLIP-seq
MIRT1057627	hsa-miR-1268b	CLIP-seq
MIRT1057628	hsa-miR-193a-3p	CLIP-seq
MIRT1057629	hsa-miR-193b	CLIP-seq
MIRT1057630	hsa-miR-2114	CLIP-seq
MIRT1057631	hsa-miR-24	CLIP-seq
MIRT1057632	hsa-miR-3116	CLIP-seq
MIRT1057633	hsa-miR-3122	CLIP-seq
MIRT1057634	hsa-miR-3545-3p	CLIP-seq
MIRT1057635	hsa-miR-3622b-5p	CLIP-seq
MIRT1057636	hsa-miR-3662	CLIP-seq
MIRT1057637	hsa-miR-3689a-3p	CLIP-seq
MIRT1057638	hsa-miR-3689c	CLIP-seq
MIRT1057639	hsa-miR-3690	CLIP-seq
MIRT1057640	hsa-miR-3913-5p	CLIP-seq
MIRT1057641	hsa-miR-4433	CLIP-seq
MIRT1057642	hsa-miR-4638-3p	CLIP-seq
MIRT1057643	hsa-miR-4688	CLIP-seq
MIRT1057644	hsa-miR-4701-3p	CLIP-seq
MIRT1057645	hsa-miR-4711-3p	CLIP-seq
MIRT1057646	hsa-miR-4726-3p	CLIP-seq
MIRT1057647	hsa-miR-4728-5p	CLIP-seq
MIRT1057648	hsa-miR-4735-5p	CLIP-seq
MIRT1057649	hsa-miR-4775	CLIP-seq
MIRT1057650	hsa-miR-4781-5p	CLIP-seq
MIRT1057651	hsa-miR-4787-3p	CLIP-seq
MIRT1057652	hsa-miR-486-3p	CLIP-seq
MIRT1057653	hsa-miR-503	CLIP-seq
MIRT1057654	hsa-miR-541	CLIP-seq
MIRT1057655	hsa-miR-548a-3p	CLIP-seq
MIRT1057656	hsa-miR-548e	CLIP-seq
MIRT1057657	hsa-miR-548f	CLIP-seq
MIRT1057658	hsa-miR-553	CLIP-seq
MIRT1057659	hsa-miR-576-5p	CLIP-seq
MIRT1057660	hsa-miR-590-3p	CLIP-seq
MIRT1057661	hsa-miR-654-5p	CLIP-seq
MIRT2013224	hsa-miR-1184	CLIP-seq
MIRT2013225	hsa-miR-1207-3p	CLIP-seq
MIRT2013226	hsa-miR-1225-3p	CLIP-seq
MIRT2013227	hsa-miR-1229	CLIP-seq
MIRT2013228	hsa-miR-1233	CLIP-seq
MIRT2013229	hsa-miR-1245b-3p	CLIP-seq
MIRT1057624	hsa-miR-1254	CLIP-seq
MIRT1057625	hsa-miR-1262	CLIP-seq
MIRT1057626	hsa-miR-1268	CLIP-seq
MIRT1057627	hsa-miR-1268b	CLIP-seq
MIRT2013230	hsa-miR-128	CLIP-seq
MIRT2013231	hsa-miR-1282	CLIP-seq
MIRT2013232	hsa-miR-1301	CLIP-seq
MIRT2013233	hsa-miR-1323	CLIP-seq
MIRT2013234	hsa-miR-150	CLIP-seq
MIRT1057628	hsa-miR-193a-3p	CLIP-seq
MIRT1057629	hsa-miR-193b	CLIP-seq
MIRT1057630	hsa-miR-2114	CLIP-seq
MIRT2013235	hsa-miR-2681	CLIP-seq
MIRT1057632	hsa-miR-3116	CLIP-seq
MIRT1057633	hsa-miR-3122	CLIP-seq
MIRT2013236	hsa-miR-3149	CLIP-seq
MIRT1057634	hsa-miR-3545-3p	CLIP-seq
MIRT2013237	hsa-miR-3612	CLIP-seq
MIRT2013238	hsa-miR-3656	CLIP-seq
MIRT2013239	hsa-miR-3682-3p	CLIP-seq
MIRT1057637	hsa-miR-3689a-3p	CLIP-seq
MIRT1057638	hsa-miR-3689c	CLIP-seq
MIRT1057640	hsa-miR-3913-5p	CLIP-seq
MIRT2013240	hsa-miR-4328	CLIP-seq
MIRT2013241	hsa-miR-433	CLIP-seq
MIRT2013242	hsa-miR-4418	CLIP-seq
MIRT1057641	hsa-miR-4433	CLIP-seq
MIRT2013243	hsa-miR-4443	CLIP-seq
MIRT2013244	hsa-miR-4504	CLIP-seq
MIRT2013245	hsa-miR-4660	CLIP-seq
MIRT2013246	hsa-miR-4684-5p	CLIP-seq
MIRT1057644	hsa-miR-4701-3p	CLIP-seq
MIRT2013247	hsa-miR-4713-5p	CLIP-seq
MIRT1057646	hsa-miR-4726-3p	CLIP-seq
MIRT1057647	hsa-miR-4728-5p	CLIP-seq
MIRT2013248	hsa-miR-4757-5p	CLIP-seq
MIRT2013249	hsa-miR-4793-5p	CLIP-seq
MIRT2013250	hsa-miR-4795-5p	CLIP-seq
MIRT2013251	hsa-miR-494	CLIP-seq
MIRT2013252	hsa-miR-5047	CLIP-seq
MIRT2013253	hsa-miR-509-3-5p	CLIP-seq
MIRT2013254	hsa-miR-509-5p	CLIP-seq
MIRT2013255	hsa-miR-532-3p	CLIP-seq
MIRT1057654	hsa-miR-541	CLIP-seq
MIRT2013256	hsa-miR-542-3p	CLIP-seq
MIRT1057655	hsa-miR-548a-3p	CLIP-seq
MIRT2013257	hsa-miR-548c-3p	CLIP-seq
MIRT1057656	hsa-miR-548e	CLIP-seq
MIRT1057657	hsa-miR-548f	CLIP-seq
MIRT2013258	hsa-miR-548o	CLIP-seq
MIRT2013259	hsa-miR-579	CLIP-seq
MIRT2013260	hsa-miR-650	CLIP-seq
MIRT1057661	hsa-miR-654-5p	CLIP-seq
MIRT1057624	hsa-miR-1254	CLIP-seq
MIRT1057625	hsa-miR-1262	CLIP-seq
MIRT1057630	hsa-miR-2114	CLIP-seq
MIRT2245504	hsa-miR-219-5p	CLIP-seq
MIRT1057632	hsa-miR-3116	CLIP-seq
MIRT1057634	hsa-miR-3545-3p	CLIP-seq
MIRT2245505	hsa-miR-3688-5p	CLIP-seq
MIRT1057639	hsa-miR-3690	CLIP-seq
MIRT2245506	hsa-miR-378g	CLIP-seq
MIRT2245507	hsa-miR-3925-3p	CLIP-seq
MIRT2245508	hsa-miR-4307	CLIP-seq
MIRT1057641	hsa-miR-4433	CLIP-seq
MIRT2245509	hsa-miR-4437	CLIP-seq
MIRT2245510	hsa-miR-4445	CLIP-seq
MIRT2245511	hsa-miR-4474-3p	CLIP-seq
MIRT1057642	hsa-miR-4638-3p	CLIP-seq
MIRT2245512	hsa-miR-4652-3p	CLIP-seq
MIRT2245513	hsa-miR-4674	CLIP-seq
MIRT1057644	hsa-miR-4701-3p	CLIP-seq
MIRT2245514	hsa-miR-4782-3p	CLIP-seq
MIRT2245515	hsa-miR-4793-3p	CLIP-seq
MIRT2013250	hsa-miR-4795-5p	CLIP-seq
MIRT2245516	hsa-miR-508-3p	CLIP-seq
MIRT2245517	hsa-miR-508-5p	CLIP-seq
MIRT2245518	hsa-miR-567	CLIP-seq
MIRT2245519	hsa-miR-622	CLIP-seq
MIRT2245520	hsa-miR-653	CLIP-seq
MIRT2245521	hsa-miR-668	CLIP-seq
MIRT2245522	hsa-miR-892a	CLIP-seq
MIRT1057625	hsa-miR-1262	CLIP-seq
MIRT1057644	hsa-miR-4701-3p	CLIP-seq
MIRT1057625	hsa-miR-1262	CLIP-seq
MIRT1057626	hsa-miR-1268	CLIP-seq
MIRT1057627	hsa-miR-1268b	CLIP-seq
MIRT1057633	hsa-miR-3122	CLIP-seq
MIRT1057634	hsa-miR-3545-3p	CLIP-seq
MIRT1057637	hsa-miR-3689a-3p	CLIP-seq
MIRT1057638	hsa-miR-3689c	CLIP-seq
MIRT1057640	hsa-miR-3913-5p	CLIP-seq
MIRT2013246	hsa-miR-4684-5p	CLIP-seq
MIRT1057644	hsa-miR-4701-3p	CLIP-seq
MIRT1057646	hsa-miR-4726-3p	CLIP-seq
MIRT1057647	hsa-miR-4728-5p	CLIP-seq
MIRT2451495	hsa-miR-4738-3p	CLIP-seq
MIRT2013257	hsa-miR-548c-3p	CLIP-seq
MIRT2013246	hsa-miR-4684-5p	CLIP-seq
MIRT2451495	hsa-miR-4738-3p	CLIP-seq
MIRT2013257	hsa-miR-548c-3p	CLIP-seq
MIRT2548678	hsa-miR-10a	CLIP-seq
MIRT2548679	hsa-miR-10b	CLIP-seq
MIRT2013224	hsa-miR-1184	CLIP-seq
MIRT2013225	hsa-miR-1207-3p	CLIP-seq
MIRT2013227	hsa-miR-1229	CLIP-seq
MIRT1057625	hsa-miR-1262	CLIP-seq
MIRT1057626	hsa-miR-1268	CLIP-seq
MIRT1057627	hsa-miR-1268b	CLIP-seq
MIRT2548680	hsa-miR-1272	CLIP-seq
MIRT2548681	hsa-miR-1273f	CLIP-seq
MIRT2013230	hsa-miR-128	CLIP-seq
MIRT2013232	hsa-miR-1301	CLIP-seq
MIRT2548682	hsa-miR-1322	CLIP-seq
MIRT2548683	hsa-miR-143	CLIP-seq
MIRT2548684	hsa-miR-186	CLIP-seq
MIRT2548685	hsa-miR-1908	CLIP-seq
MIRT1057630	hsa-miR-2114	CLIP-seq
MIRT2548686	hsa-miR-2116	CLIP-seq
MIRT2013235	hsa-miR-2681	CLIP-seq
MIRT2548687	hsa-miR-2682	CLIP-seq
MIRT2548688	hsa-miR-3120-3p	CLIP-seq
MIRT1057633	hsa-miR-3122	CLIP-seq
MIRT2013236	hsa-miR-3149	CLIP-seq
MIRT2548689	hsa-miR-3163	CLIP-seq
MIRT2548690	hsa-miR-3194-3p	CLIP-seq
MIRT2548691	hsa-miR-339-5p	CLIP-seq
MIRT2548692	hsa-miR-340	CLIP-seq
MIRT2548693	hsa-miR-34a	CLIP-seq
MIRT2548694	hsa-miR-34c-5p	CLIP-seq
MIRT1057634	hsa-miR-3545-3p	CLIP-seq
MIRT2013237	hsa-miR-3612	CLIP-seq
MIRT2548695	hsa-miR-3613-3p	CLIP-seq
MIRT1057635	hsa-miR-3622b-5p	CLIP-seq
MIRT2548696	hsa-miR-3647-3p	CLIP-seq
MIRT2548697	hsa-miR-3671	CLIP-seq
MIRT2548698	hsa-miR-3672	CLIP-seq
MIRT1057637	hsa-miR-3689a-3p	CLIP-seq
MIRT1057638	hsa-miR-3689c	CLIP-seq
MIRT2548699	hsa-miR-369-3p	CLIP-seq
MIRT2548700	hsa-miR-3714	CLIP-seq
MIRT2548701	hsa-miR-371-5p	CLIP-seq
MIRT2548702	hsa-miR-371b-5p	CLIP-seq
MIRT2548703	hsa-miR-374a	CLIP-seq
MIRT2548704	hsa-miR-374b	CLIP-seq
MIRT2548705	hsa-miR-380	CLIP-seq
MIRT1057640	hsa-miR-3913-5p	CLIP-seq
MIRT2548706	hsa-miR-3921	CLIP-seq
MIRT2548707	hsa-miR-3926	CLIP-seq
MIRT2548708	hsa-miR-3942-3p	CLIP-seq
MIRT2548709	hsa-miR-3960	CLIP-seq
MIRT2548710	hsa-miR-409-3p	CLIP-seq
MIRT2013240	hsa-miR-4328	CLIP-seq
MIRT2013241	hsa-miR-433	CLIP-seq
MIRT2013242	hsa-miR-4418	CLIP-seq
MIRT2548711	hsa-miR-4421	CLIP-seq
MIRT2548712	hsa-miR-4436a	CLIP-seq
MIRT2013243	hsa-miR-4443	CLIP-seq
MIRT2548713	hsa-miR-4467	CLIP-seq
MIRT2548714	hsa-miR-4476	CLIP-seq
MIRT2548715	hsa-miR-4496	CLIP-seq
MIRT2548716	hsa-miR-449a	CLIP-seq
MIRT2548717	hsa-miR-449b	CLIP-seq
MIRT2548718	hsa-miR-449c	CLIP-seq
MIRT2548719	hsa-miR-4517	CLIP-seq
MIRT2245512	hsa-miR-4652-3p	CLIP-seq
MIRT2548720	hsa-miR-4653-5p	CLIP-seq
MIRT2013245	hsa-miR-4660	CLIP-seq
MIRT2548721	hsa-miR-4677-5p	CLIP-seq
MIRT2548722	hsa-miR-4682	CLIP-seq
MIRT2013246	hsa-miR-4684-5p	CLIP-seq
MIRT2548723	hsa-miR-4687-3p	CLIP-seq
MIRT2548724	hsa-miR-4700-3p	CLIP-seq
MIRT1057644	hsa-miR-4701-3p	CLIP-seq
MIRT2548725	hsa-miR-4708-5p	CLIP-seq
MIRT2548726	hsa-miR-4712-3p	CLIP-seq
MIRT2548727	hsa-miR-4725-5p	CLIP-seq
MIRT1057646	hsa-miR-4726-3p	CLIP-seq
MIRT1057647	hsa-miR-4728-5p	CLIP-seq
MIRT2451495	hsa-miR-4738-3p	CLIP-seq
MIRT2548728	hsa-miR-4738-5p	CLIP-seq
MIRT2548729	hsa-miR-4753-3p	CLIP-seq
MIRT2548730	hsa-miR-4770	CLIP-seq
MIRT1057649	hsa-miR-4775	CLIP-seq
MIRT2548731	hsa-miR-4786-5p	CLIP-seq
MIRT1057651	hsa-miR-4787-3p	CLIP-seq
MIRT2013249	hsa-miR-4793-5p	CLIP-seq
MIRT2013250	hsa-miR-4795-5p	CLIP-seq
MIRT2548732	hsa-miR-495	CLIP-seq
MIRT2548733	hsa-miR-504	CLIP-seq
MIRT2013252	hsa-miR-5047	CLIP-seq
MIRT2245517	hsa-miR-508-5p	CLIP-seq
MIRT2013253	hsa-miR-509-3-5p	CLIP-seq
MIRT2013254	hsa-miR-509-5p	CLIP-seq
MIRT1057654	hsa-miR-541	CLIP-seq
MIRT2013256	hsa-miR-542-3p	CLIP-seq
MIRT1057655	hsa-miR-548a-3p	CLIP-seq
MIRT2548734	hsa-miR-548aa	CLIP-seq
MIRT2548735	hsa-miR-548ac	CLIP-seq
MIRT2013257	hsa-miR-548c-3p	CLIP-seq
MIRT2548736	hsa-miR-548d-3p	CLIP-seq
MIRT1057656	hsa-miR-548e	CLIP-seq
MIRT1057657	hsa-miR-548f	CLIP-seq
MIRT2548737	hsa-miR-548s	CLIP-seq
MIRT2548738	hsa-miR-548z	CLIP-seq
MIRT2548739	hsa-miR-570	CLIP-seq
MIRT2013259	hsa-miR-579	CLIP-seq
MIRT2548740	hsa-miR-593	CLIP-seq
MIRT2548741	hsa-miR-606	CLIP-seq
MIRT2548742	hsa-miR-607	CLIP-seq
MIRT2013260	hsa-miR-650	CLIP-seq
MIRT1057661	hsa-miR-654-5p	CLIP-seq
MIRT2548743	hsa-miR-663	CLIP-seq
MIRT2245521	hsa-miR-668	CLIP-seq
MIRT2548744	hsa-miR-766	CLIP-seq
MIRT2548745	hsa-miR-769-5p	CLIP-seq
MIRT2548746	hsa-miR-885-5p	CLIP-seq
MIRT2548747	hsa-miR-944	CLIP-seq
MIRT1057625	hsa-miR-1262	CLIP-seq
MIRT1057626	hsa-miR-1268	CLIP-seq
MIRT1057627	hsa-miR-1268b	CLIP-seq
MIRT2548680	hsa-miR-1272	CLIP-seq
MIRT2548681	hsa-miR-1273f	CLIP-seq
MIRT2013230	hsa-miR-128	CLIP-seq
MIRT2548682	hsa-miR-1322	CLIP-seq
MIRT2548683	hsa-miR-143	CLIP-seq
MIRT1057630	hsa-miR-2114	CLIP-seq
MIRT2013235	hsa-miR-2681	CLIP-seq
MIRT2548688	hsa-miR-3120-3p	CLIP-seq
MIRT1057633	hsa-miR-3122	CLIP-seq
MIRT2548689	hsa-miR-3163	CLIP-seq
MIRT2548692	hsa-miR-340	CLIP-seq
MIRT1057634	hsa-miR-3545-3p	CLIP-seq
MIRT2548695	hsa-miR-3613-3p	CLIP-seq
MIRT1057635	hsa-miR-3622b-5p	CLIP-seq
MIRT2548698	hsa-miR-3672	CLIP-seq
MIRT1057637	hsa-miR-3689a-3p	CLIP-seq
MIRT1057638	hsa-miR-3689c	CLIP-seq
MIRT2548699	hsa-miR-369-3p	CLIP-seq
MIRT2548701	hsa-miR-371-5p	CLIP-seq
MIRT2548702	hsa-miR-371b-5p	CLIP-seq
MIRT2548703	hsa-miR-374a	CLIP-seq
MIRT2548704	hsa-miR-374b	CLIP-seq
MIRT2548705	hsa-miR-380	CLIP-seq
MIRT1057640	hsa-miR-3913-5p	CLIP-seq
MIRT2548707	hsa-miR-3926	CLIP-seq
MIRT2548710	hsa-miR-409-3p	CLIP-seq
MIRT2245508	hsa-miR-4307	CLIP-seq
MIRT2013240	hsa-miR-4328	CLIP-seq
MIRT2548712	hsa-miR-4436a	CLIP-seq
MIRT2548715	hsa-miR-4496	CLIP-seq
MIRT2548719	hsa-miR-4517	CLIP-seq
MIRT2013246	hsa-miR-4684-5p	CLIP-seq
MIRT2548724	hsa-miR-4700-3p	CLIP-seq
MIRT1057644	hsa-miR-4701-3p	CLIP-seq
MIRT2548725	hsa-miR-4708-5p	CLIP-seq
MIRT1057646	hsa-miR-4726-3p	CLIP-seq
MIRT1057647	hsa-miR-4728-5p	CLIP-seq
MIRT2451495	hsa-miR-4738-3p	CLIP-seq
MIRT2548728	hsa-miR-4738-5p	CLIP-seq
MIRT2548729	hsa-miR-4753-3p	CLIP-seq
MIRT2548730	hsa-miR-4770	CLIP-seq
MIRT2548731	hsa-miR-4786-5p	CLIP-seq
MIRT1057651	hsa-miR-4787-3p	CLIP-seq
MIRT2013249	hsa-miR-4793-5p	CLIP-seq
MIRT2013250	hsa-miR-4795-5p	CLIP-seq
MIRT2548732	hsa-miR-495	CLIP-seq
MIRT2245517	hsa-miR-508-5p	CLIP-seq
MIRT1057654	hsa-miR-541	CLIP-seq
MIRT2548734	hsa-miR-548aa	CLIP-seq
MIRT2548735	hsa-miR-548ac	CLIP-seq
MIRT2013257	hsa-miR-548c-3p	CLIP-seq
MIRT2548736	hsa-miR-548d-3p	CLIP-seq
MIRT2548737	hsa-miR-548s	CLIP-seq
MIRT2548738	hsa-miR-548z	CLIP-seq
MIRT2245518	hsa-miR-567	CLIP-seq
MIRT2548739	hsa-miR-570	CLIP-seq
MIRT2548740	hsa-miR-593	CLIP-seq
MIRT1057661	hsa-miR-654-5p	CLIP-seq
MIRT2548744	hsa-miR-766	CLIP-seq
MIRT2548745	hsa-miR-769-5p	CLIP-seq
MIRT2548747	hsa-miR-944	CLIP-seq

Gene ontology (GO) Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000077	Process	DNA damage checkpoint signaling	IEA
GO:0000077	Process	DNA damage checkpoint signaling	IEA
GO:0000077	Process	DNA damage checkpoint signaling	IMP	21659603
GO:0000077	Process	DNA damage checkpoint signaling	NAS	19464297
GO:0000077	Process	DNA damage checkpoint signaling	TAS	9878245
GO:0000723	Process	Telomere maintenance	IBA
GO:0000724	Process	Double-strand break repair via homologous recombination	IBA
GO:0000724	Process	Double-strand break repair via homologous recombination	IEA
GO:0005515	Function	Protein binding	IPI	10359610, 10846170, 10884395, 14624239, 19464297, 28514442, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	10846170
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006281	Process	DNA repair	TAS	9872989
GO:0006289	Process	Nucleotide-excision repair	IBA
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	TAS	9872989
GO:0009314	Process	Response to radiation	IEA
GO:0009411	Process	Response to UV	IEA
GO:0009792	Process	Embryo development ending in birth or egg hatching	IEA
GO:0030896	Component	Checkpoint clamp complex	IBA
GO:0030896	Component	Checkpoint clamp complex	IDA	31776186, 36841485
GO:0030896	Component	Checkpoint clamp complex	IEA
GO:0030896	Component	Checkpoint clamp complex	IPI	19464297
GO:0031573	Process	Mitotic intra-S DNA damage checkpoint signaling	IBA
GO:0033314	Process	Mitotic DNA replication checkpoint signaling	IBA
GO:0035861	Component	Site of double-strand break	IBA
GO:0044778	Process	Meiotic DNA integrity checkpoint signaling	IBA
GO:0071479	Process	Cellular response to ionizing radiation	IDA	21659603

Other IDs

• MIM: 603760
• HGNC: 5309
• e!Ensembl: ENSG00000136273

Protein

• UniProt ID: O60921
• Protein name: Checkpoint protein HUS1 (hHUS1)
• Protein function: Component of the 9-1-1 cell-cycle checkpoint response complex that plays a major role in DNA repair (PubMed:21659603). The 9-1-1 complex is recruited to DNA lesion upon damage by the RAD17-replication factor C (RFC) clamp loader complex (PubMed:
• PDB: 3A1J , 3G65 , 3GGR , 6J8Y , 7Z6H , 8GNN , 8WU8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04005	Hus1	1 → 280	Hus1-like protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:10777662}.
• Sequence:

  MKFRAKIVDGACLNHFTRISNMIAKLAKTCTLRISPDKLNFILCDKLANGGVSMWCELEQ
  ENFFNEFQMEGVSAENNEIYLELTSENLSRALKTAQNARALKIKLTNKHFPCLTVSVELL
  SMSSSSRIVTHDIPIKVIPRKLWKDLQEPVVPDPDVSIYLPVLKTMKSVVEKMKNISNHL
  VIEANLDGELNLKIETELVCVTTHFKDLGNPPLASESTHEDRNVEHMAEVHIDIRKLLQF
  LAGQQVNPTKALCNIVNNKMVHFDLLHEDVSLQYFIPALS

• Sequence length: 280

Pathways

KEGG Pathway	Reactome Pathway
Cellular senescence	Activation of ATR in response to replication stress
	HDR through Single Strand Annealing (SSA)
	Processing of DNA double-strand break ends
	Presynaptic phase of homologous DNA pairing and strand exchange
	Regulation of TP53 Activity through Phosphorylation
	G2/M DNA damage checkpoint

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (6)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Clear cell carcinoma of kidney	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (13)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	25520248		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22926736		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37086071	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30182378		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25520248		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22926736		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22926736		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30182378		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22926736		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	21642358		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34925643	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	21642358	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	30107825	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

RAD9B 7 shared pathwaysCellular senescence, HDR through Single Strand Annealing (SSA), Processing of DNA double-strand break ends, Presynaptic phase of homologous DNA pairing and strand exchange, Regulation of TP53 Activity through Phosphorylation, G2/M DNA damage checkpoint, Activation of ATR in response to replication stress Related via 7 shared pathways including Cellular senescence, HDR through Single Strand Annealing (SSA). RAD1 7 shared pathwaysCellular senescence, HDR through Single Strand Annealing (SSA), Processing of DNA double-strand break ends, Presynaptic phase of homologous DNA pairing and strand exchange, Regulation of TP53 Activity through Phosphorylation, G2/M DNA damage checkpoint, Activation of ATR in response to replication stress Related via 7 shared pathways including Cellular senescence, HDR through Single Strand Annealing (SSA). RAD9A 7 shared pathwaysCellular senescence, HDR through Single Strand Annealing (SSA), Processing of DNA double-strand break ends, Presynaptic phase of homologous DNA pairing and strand exchange, Regulation of TP53 Activity through Phosphorylation, G2/M DNA damage checkpoint, Activation of ATR in response to replication stress Related via 7 shared pathways including Cellular senescence, HDR through Single Strand Annealing (SSA). RAD17 6 shared pathwaysHDR through Single Strand Annealing (SSA), Processing of DNA double-strand break ends, Presynaptic phase of homologous DNA pairing and strand exchange, Regulation of TP53 Activity through Phosphorylation, G2/M DNA damage checkpoint, Activation of ATR in response to replication stress Related via 6 shared pathways including HDR through Single Strand Annealing (SSA), Processing of DNA double-strand break ends. ATRIP 6 shared pathwaysHDR through Single Strand Annealing (SSA), Processing of DNA double-strand break ends, Presynaptic phase of homologous DNA pairing and strand exchange, Regulation of TP53 Activity through Phosphorylation, G2/M DNA damage checkpoint, Activation of ATR in response to replication stress Related via 6 shared pathways including HDR through Single Strand Annealing (SSA), Processing of DNA double-strand break ends.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
RAD9B	0	[]	7	["Cellular senescence","HDR through Single Strand Annealing (SSA)","Processing of DNA double-strand break ends","Presynaptic phase of homologous DNA pairing and strand exchange","Regulation of TP53 Activity through Phosphorylation","G2\/M DNA damage checkpoint","Activation of ATR in response to replication stress"]	0	[]
RAD1	0	[]	7	["Cellular senescence","HDR through Single Strand Annealing (SSA)","Processing of DNA double-strand break ends","Presynaptic phase of homologous DNA pairing and strand exchange","Regulation of TP53 Activity through Phosphorylation","G2\/M DNA damage checkpoint","Activation of ATR in response to replication stress"]	0	[]
RAD9A	0	[]	7	["Cellular senescence","HDR through Single Strand Annealing (SSA)","Processing of DNA double-strand break ends","Presynaptic phase of homologous DNA pairing and strand exchange","Regulation of TP53 Activity through Phosphorylation","G2\/M DNA damage checkpoint","Activation of ATR in response to replication stress"]	0	[]
RAD17	0	[]	6	["HDR through Single Strand Annealing (SSA)","Processing of DNA double-strand break ends","Presynaptic phase of homologous DNA pairing and strand exchange","Regulation of TP53 Activity through Phosphorylation","G2\/M DNA damage checkpoint","Activation of ATR in response to replication stress"]	0	[]
ATRIP	0	[]	6	["HDR through Single Strand Annealing (SSA)","Processing of DNA double-strand break ends","Presynaptic phase of homologous DNA pairing and strand exchange","Regulation of TP53 Activity through Phosphorylation","G2\/M DNA damage checkpoint","Activation of ATR in response to replication stress"]	0	[]

Diseases Linked via Similar Genes

Neural tube defect Linked via 1 of 5 related genesRAD9B Atrial fibrillation Linked via 1 of 5 related genesRAD9A Osteoarthritis Linked via 1 of 5 related genesRAD9A Multiple sclerosis Linked via 1 of 5 related genesRAD17 Breast cancer Linked via 1 of 5 related genesATRIP

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Neural tube defect	1	["RAD9B"]
Atrial fibrillation	1	["RAD9A"]
Osteoarthritis	1	["RAD9A"]
Multiple sclerosis	1	["RAD17"]
Breast cancer	1	["ATRIP"]