RHBDF2 (rhomboid 5 homolog 2)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 79651
• Gene name: Rhomboid 5 homolog 2
• Gene symbol: RHBDF2
• Synonyms (NCBI Gene): RHBDL5, RHBDL6, TOC, TOCG, iRhom2
• Chromosome: 17
• Chromosome location: 17q25.1

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs387907129	A>G	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs387907130	G>A	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant

miRNA Show/Hide all (34)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017408	hsa-miR-335-5p	Microarray	18185580
MIRT025648	hsa-miR-7-5p	Microarray	19073608
MIRT027569	hsa-miR-98-5p	Microarray	19088304
MIRT039628	hsa-miR-615-3p	CLASH	23622248
MIRT027569	hsa-miR-98-5p	PAR-CLIP	26701625
MIRT027569	hsa-miR-98-5p	PAR-CLIP	26701625
MIRT2090277	hsa-miR-1827	CLIP-seq
MIRT2315096	hsa-miR-1193	CLIP-seq
MIRT2315097	hsa-miR-1224-5p	CLIP-seq
MIRT2315098	hsa-miR-1226	CLIP-seq
MIRT2315099	hsa-miR-124	CLIP-seq
MIRT2315100	hsa-miR-1246	CLIP-seq
MIRT2315101	hsa-miR-1275	CLIP-seq
MIRT2090277	hsa-miR-1827	CLIP-seq
MIRT2315102	hsa-miR-3175	CLIP-seq
MIRT2315103	hsa-miR-3661	CLIP-seq
MIRT2315104	hsa-miR-4434	CLIP-seq
MIRT2315105	hsa-miR-4447	CLIP-seq
MIRT2315106	hsa-miR-4472	CLIP-seq
MIRT2315107	hsa-miR-4516	CLIP-seq
MIRT2315108	hsa-miR-4525	CLIP-seq
MIRT2315109	hsa-miR-4530	CLIP-seq
MIRT2315110	hsa-miR-4646-5p	CLIP-seq
MIRT2315111	hsa-miR-4665-5p	CLIP-seq
MIRT2315112	hsa-miR-4723-5p	CLIP-seq
MIRT2315113	hsa-miR-4747-5p	CLIP-seq
MIRT2315114	hsa-miR-4751	CLIP-seq
MIRT2315115	hsa-miR-492	CLIP-seq
MIRT2315116	hsa-miR-506	CLIP-seq
MIRT2315117	hsa-miR-625	CLIP-seq
MIRT2315118	hsa-miR-631	CLIP-seq
MIRT2315119	hsa-miR-634	CLIP-seq
MIRT2315120	hsa-miR-885-3p	CLIP-seq
MIRT2315121	hsa-miR-922	CLIP-seq

Gene ontology (GO) Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	TAS
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0005515	Function	Protein binding	IPI	29897333, 29897336
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	ISS
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	IDA	22265016
GO:0005886	Component	Plasma membrane	IEA
GO:0012505	Component	Endomembrane system	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0019838	Function	Growth factor binding	IEA
GO:0042058	Process	Regulation of epidermal growth factor receptor signaling pathway	IBA
GO:0050708	Process	Regulation of protein secretion	IBA
GO:0050709	Process	Negative regulation of protein secretion	IEA
GO:0050709	Process	Negative regulation of protein secretion	ISS
GO:0072659	Process	Protein localization to plasma membrane	IEA
GO:0140318	Function	Protein transporter activity	TAS

Other IDs

• MIM: 614404
• HGNC: 20788
• e!Ensembl: ENSG00000129667

Protein

• UniProt ID: Q6PJF5
• Protein name: Inactive rhomboid protein 2 (iRhom2) (Rhomboid 5 homolog 2) (Rhomboid family member 2) (Rhomboid veinlet-like protein 5) (Rhomboid veinlet-like protein 6)
• Protein function: Regulates ADAM17 protease, a sheddase of the epidermal growth factor (EGF) receptor ligands and TNF, thereby plays a role in sleep, cell survival, proliferation, migration and inflammation. Does not exhibit any protease activity on its own. {ECO
• PDB: 8SNL , 8SNM , 8SNN , 8SNO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01694	Rhomboid	648 → 792	Rhomboid family	Family
  PF12595	Rhomboid_SP	128 → 334	Rhomboid serine protease	Family

• Tissue specificity: TISSUE SPECIFICITY: Found in the epidermis and esophageal epithelium. {ECO:0000269|PubMed:22265016}.
• Sequence:

  MASADKNGGSVSSVSSSRLQSRKPPNLSITIPPPEKETQAPGEQDSMLPEGFQNRRLKKS
  QPRTWAAHTTACPPSFLPKRKNPAYLKSVSLQEPRSRWQESSEKRPGFRRQASLSQSIRK
  GAAQWFGVSGDWEGQRQQWQRRSLHHCSMRYGRLKASCQRDLELPSQEAPSFQGTESPKP
  CKMPKIVDPLARGRAFRHPEEMDRPHAPHPPLTPGVLSLTSFTSVRSGYSHLPRRKRMSV
  AHMSLQAAAALLKGRSVLDATGQRCRVVKRSFAFPSFLEEDVVDGADTFDSSFFSKEEMS
  SMPDDVFESPPLSASYFRGIPHSASPVSPDGVQIPLKEYGRAPVPGPRRGKRIASKVKHF
  AFDRKKRHYGLGVVGNWLNRSYRRSISSTVQRQLESFDSHRPYFTYWLTFVHVIITLLVI
  CTYGIAPVGFAQHVTTQLVLRNKGVYESVKYIQQENFWVGPSSIDLIHLGAKFSPCIRKD
  GQIEQLVLRERDLERDSGCCVQNDHSGCIQTQRKDCSETLATFVKWQDDTGPPMDKSDLG
  QKRTSGAVCHQDPRTCEEPASSGAHIWPDDITKWPICTEQARSNHTGFLHMDCEIKGRPC
  CIGTKGSCEITTREYCEFMHGYFHEEATLCSQVHCLDKVCGLLPFLNPEVPDQFYRLWLS
  LFLHAGVVHCLVSVVFQMTILRDLEKLAGWHRIAIIFILSGITGNLASAIFLPYRAEVGP
  AGSQFGLLACLFVELFQSWPLLERPWKAFLNLSAIVLFLFICGLLPWIDNIAHIFGFLSG
  LLLAFAFLPYITFGTSDKYRKRALILVSLLAFAGLFAALVLWLYIYPINWPWIEHLTCFP
  FTSRFCEKYELDQVLH

• Sequence length: 856

Pathways

KEGG Pathway:

TNF signaling pathway

Reactome Pathway:

CD163 mediating an anti-inflammatory response

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Palmoplantar keratoderma-esophageal carcinoma syndrome	Likely pathogenic; Pathogenic	rs387907129	RCV000024177	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (19)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatoblastoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHBDF2-related disorder	Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (82)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult Rickets	Rickets	BEFREE	30672760		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	25129075, 31775875	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30097271		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	23348744, 28815577		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	31815152	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30097271		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	29532101		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24218030		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36452073	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31661139, 36452073	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	19294737		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36943228	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	30248495		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22344671		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31661139		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	31661139		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	31662486		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29369823, 30165303		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30694569, 31586441		★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	28655741, 29523849		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29221422		★☆☆☆☆ Found in Text Mining only
Diffuse palmoplantar hyperkeratosis	Diffuse palmoplantar hyperkeratosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	28965953		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	10092133, 11346464, 12691822, 22265016, 9609757		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	10092133, 12691822, 22265016, 9609757		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	22265016	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	HPO_DG			★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	22265016	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	36943228	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	26535007		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31662485, 31662486		★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	BEFREE	30516678		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	31815152	Associate	★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	BEFREE	10631907, 11346464, 12691822, 17046844, 22265016, 24643277, 26419362, 28165652, 28655741, 9609757, 9798681		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	28815577		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	31815152	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30694569, 31586441		★☆☆☆☆ Found in Text Mining only
Keratoderma Palmoplantar Epidermolytic	Epidermolytic palmoplantar keratoderma	Pubtator	22265016	Associate	★☆☆☆☆ Found in Text Mining only
Keratoderma, Palmoplantar	Palmoplantar keratoderma	BEFREE	29523849		★☆☆☆☆ Found in Text Mining only
Keratoderma, Palmoplantar	Palmoplantar keratoderma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Keratoderma, Palmoplantar, Diffuse	Palmoplantar keratoderma	BEFREE	10631907, 11346464, 12691822, 17046844, 22265016, 24643277, 26419362, 28165652, 28655741, 9609757, 9798681		★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	GENOMICS_ENGLAND_DG	22265016, 22638770		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	31815152	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	29369823, 30540578, 30672908		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36943228	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10092133, 24218030		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	10092133, 11346464, 12691822, 15254736, 22265016, 24643277, 26419362, 29523849, 9609757, 9798681		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19294737, 22344671		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	30940668		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15254736, 26535007		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31661139		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10092133		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	30877475		★☆☆☆☆ Found in Text Mining only
Mouth Abnormalities	Mouth Abnormalities	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29415889		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22344671, 28572490, 29523849, 29532101, 29926342, 30672760, 31365494, 31661139		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	28164207, 29533417, 31079574, 31365494		★☆☆☆☆ Found in Text Mining only
Osteomalacia	Osteomalacia	BEFREE	30672760		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29776906		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22344671		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32236893	Associate	★☆☆☆☆ Found in Text Mining only
PALMOPLANTAR KERATODERMA, NONEPIDERMOLYTIC	Nonepidermolytic palmoplantar keratoderma	BEFREE	10631907, 11346464, 12691822, 17046844, 22265016, 24643277, 26419362, 28165652, 28655741, 9609757, 9798681		★☆☆☆☆ Found in Text Mining only
Palmoplantar keratoderma-esophageal carcinoma syndrome	Palmoplantar Keratoderma-Esophageal Carcinoma Syndrome	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Parakeratosis	Parakeratosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29776906, 31369701		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22265016		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	10631907, 17046844		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32236893	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	30940668		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	30940668		★☆☆☆☆ Found in Text Mining only
TYLOSIS WITH ESOPHAGEAL CANCER	Palmoplantar keratoderma-esophageal carcinoma syndrome	GENOMICS_ENGLAND_DG	22265016, 22638770		★☆☆☆☆ Found in Text Mining only
TYLOSIS WITH ESOPHAGEAL CANCER	Palmoplantar keratoderma-esophageal carcinoma syndrome	ORPHANET_DG	22265016		★☆☆☆☆ Found in Text Mining only
TYLOSIS WITH ESOPHAGEAL CANCER	Palmoplantar keratoderma-esophageal carcinoma syndrome	UNIPROT_DG	22265016		★☆☆☆☆ Found in Text Mining only
TYLOSIS WITH ESOPHAGEAL CANCER	Palmoplantar keratoderma-esophageal carcinoma syndrome	BEFREE	22638770, 26535007, 30022999, 30672760		★☆☆☆☆ Found in Text Mining only
TYLOSIS WITH ESOPHAGEAL CANCER	Palmoplantar keratoderma-esophageal carcinoma syndrome	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
TYLOSIS WITH ESOPHAGEAL CANCER	Palmoplantar keratoderma-esophageal carcinoma syndrome	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31661139	Associate	★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	30516678		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

ADAM17 2 shared pathwaysTNF signaling pathway, CD163 mediating an anti-inflammatory response Related via 2 shared pathways including TNF signaling pathway, CD163 mediating an anti-inflammatory response. IL6 2 shared pathwaysTNF signaling pathway, CD163 mediating an anti-inflammatory response Related via 2 shared pathways including TNF signaling pathway, CD163 mediating an anti-inflammatory response. MAPK14 2 shared pathwaysTNF signaling pathway, CD163 mediating an anti-inflammatory response Related via 2 shared pathways including TNF signaling pathway, CD163 mediating an anti-inflammatory response.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
ADAM17	0	[]	2	["TNF signaling pathway","CD163 mediating an anti-inflammatory response"]	0	[]
IL6	0	[]	2	["TNF signaling pathway","CD163 mediating an anti-inflammatory response"]	0	[]
MAPK14	0	[]	2	["TNF signaling pathway","CD163 mediating an anti-inflammatory response"]	0	[]

Diseases Linked via Similar Genes

Colitis Linked via 2 of 3 related genesADAM17, IL6 Diabetes mellitus type 2 Linked via 2 of 3 related genesADAM17, IL6 Inflammatory bowel disease Linked via 2 of 3 related genesADAM17, IL6 Rheumatoid arthritis Linked via 2 of 3 related genesIL6, MAPK14 Cardiomyopathy Linked via 2 of 3 related genesIL6, MAPK14

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Colitis	2	["ADAM17","IL6"]
Diabetes mellitus type 2	2	["ADAM17","IL6"]
Inflammatory bowel disease	2	["ADAM17","IL6"]
Rheumatoid arthritis	2	["IL6","MAPK14"]
Cardiomyopathy	2	["IL6","MAPK14"]