Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	1432
Gene name	Mitogen-activated protein kinase 14
Gene symbol	MAPK14
Synonyms (NCBI Gene)	CSBPCSBP1CSBP2CSPB1EXIPMxi2PRKM14PRKM15RKSAPK2Ap38p38ALPHA
Chromosome	6
Chromosome location	6p21.31
Summary	The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription

712

Show/Hide all (712)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003986	hsa-miR-199a-3p	Western blot	18456660
MIRT002610	hsa-miR-124-3p	Microarray	15685193
MIRT002950	hsa-miR-24-3p	Luciferase reporter assay	15131085
MIRT006423	hsa-miR-200a-3p	Luciferase reporter assayMicroarrayWestern blot	22101765
MIRT006423	hsa-miR-200a-3p	Luciferase reporter assayMicroarrayWestern blot	22101765
MIRT006424	hsa-miR-141-3p	Luciferase reporter assayMicroarrayWestern blot	22101765
MIRT006424	hsa-miR-141-3p	Luciferase reporter assayMicroarrayWestern blot	22101765
MIRT006423	hsa-miR-200a-3p	Luciferase reporter assayMicroarrayWestern blot	22101765
MIRT006423	hsa-miR-200a-3p	Luciferase reporter assayMicroarrayWestern blot	22101765
MIRT006424	hsa-miR-141-3p	Luciferase reporter assayMicroarrayWestern blot	22101765
MIRT006424	hsa-miR-141-3p	Luciferase reporter assayMicroarrayWestern blot	22101765
MIRT006423	hsa-miR-200a-3p	Luciferase reporter assayMicroarrayWestern blot	22101765
MIRT006423	hsa-miR-200a-3p	Luciferase reporter assayMicroarrayWestern blot	22101765
MIRT006424	hsa-miR-141-3p	Luciferase reporter assayMicroarrayWestern blot	22101765
MIRT006424	hsa-miR-141-3p	Luciferase reporter assayMicroarrayWestern blot	22101765
MIRT007066	hsa-miR-125b-5p	ChIP-seqEMSAImmunoblotLuciferase reporter assayqRT-PCRWestern blot	22854965
MIRT007066	hsa-miR-125b-5p	ChIP-seqEMSAImmunoblotLuciferase reporter assayqRT-PCRWestern blot	22854965
MIRT002610	hsa-miR-124-3p	Microarray	18668037
MIRT002610	hsa-miR-124-3p	Microarray	15685193
MIRT002610	hsa-miR-124-3p	Other	15806104
MIRT002950	hsa-miR-24-3p	Reporter assay;Other	15131085
MIRT053190	hsa-miR-214-3p	MicroarrayqRT-PCR	22929890
MIRT053435	hsa-miR-155-5p	Microarray	23807165
MIRT054882	hsa-miR-17-5p	ImmunocytochemistryImmunohistochemistryqRT-PCR	24474786
MIRT054883	hsa-miR-106a-5p	ImmunocytochemistryImmunohistochemistryqRT-PCR	24474786
MIRT002610	hsa-miR-124-3p	ImmunoblotLuciferase reporter assayqRT-PCR	23109423
MIRT438435	hsa-miR-128-3p	ImmunoblotLuciferase reporter assayqRT-PCR	23109423
MIRT002610	hsa-miR-124-3p	ImmunoblotLuciferase reporter assayqRT-PCR	23109423
MIRT438435	hsa-miR-128-3p	ImmunoblotLuciferase reporter assayqRT-PCR	23109423
MIRT724877	hsa-miR-590-3p	HITS-CLIP	19536157
MIRT724876	hsa-miR-4735-5p	HITS-CLIP	19536157
MIRT724875	hsa-miR-643	HITS-CLIP	19536157
MIRT724874	hsa-miR-6831-3p	HITS-CLIP	19536157
MIRT724873	hsa-miR-4775	HITS-CLIP	19536157
MIRT724872	hsa-miR-7159-3p	HITS-CLIP	19536157
MIRT724871	hsa-miR-4482-3p	HITS-CLIP	19536157
MIRT715172	hsa-miR-181a-2-3p	HITS-CLIP	19536157
MIRT715171	hsa-miR-205-5p	HITS-CLIP	19536157
MIRT715170	hsa-miR-4252	HITS-CLIP	19536157
MIRT715169	hsa-miR-513b-5p	HITS-CLIP	19536157
MIRT715168	hsa-miR-4279	HITS-CLIP	19536157
MIRT715167	hsa-miR-3064-3p	HITS-CLIP	19536157
MIRT715166	hsa-miR-4715-3p	HITS-CLIP	19536157
MIRT715165	hsa-miR-629-3p	HITS-CLIP	19536157
MIRT667461	hsa-miR-1250-3p	HITS-CLIP	23824327
MIRT667460	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT675820	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT675819	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT667459	hsa-miR-4469	HITS-CLIP	23824327
MIRT667458	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT667457	hsa-miR-4287	HITS-CLIP	23824327
MIRT667456	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT667455	hsa-miR-1267	HITS-CLIP	23824327
MIRT667454	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT667452	hsa-miR-4294	HITS-CLIP	23824327
MIRT667453	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT667451	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT675818	hsa-miR-5696	HITS-CLIP	23824327
MIRT667450	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT667449	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT675817	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT667448	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT667447	hsa-miR-3672	HITS-CLIP	23824327
MIRT667446	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT667445	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT667444	hsa-miR-8055	HITS-CLIP	23824327
MIRT675816	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT667443	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT667461	hsa-miR-1250-3p	HITS-CLIP	23824327
MIRT667460	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT667459	hsa-miR-4469	HITS-CLIP	23824327
MIRT667458	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT667457	hsa-miR-4287	HITS-CLIP	23824327
MIRT667456	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT667455	hsa-miR-1267	HITS-CLIP	23824327
MIRT667454	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT667452	hsa-miR-4294	HITS-CLIP	23824327
MIRT667453	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT667451	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT667450	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT667449	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT667448	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT667447	hsa-miR-3672	HITS-CLIP	23824327
MIRT667446	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT667445	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT667444	hsa-miR-8055	HITS-CLIP	23824327
MIRT667443	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT006424	hsa-miR-141-3p	HITS-CLIP	23824327
MIRT006423	hsa-miR-200a-3p	HITS-CLIP	23824327
MIRT614933	hsa-miR-6757-3p	HITS-CLIP	23824327
MIRT614932	hsa-miR-3164	HITS-CLIP	23824327
MIRT614931	hsa-miR-6820-3p	HITS-CLIP	23824327
MIRT656466	hsa-miR-34b-3p	HITS-CLIP	23824327
MIRT656465	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT656464	hsa-miR-4719	HITS-CLIP	23824327
MIRT656463	hsa-miR-548aw	HITS-CLIP	23824327
MIRT168656	hsa-miR-518a-5p	HITS-CLIP	23824327
MIRT168657	hsa-miR-527	HITS-CLIP	23824327
MIRT656462	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT656461	hsa-miR-764	HITS-CLIP	23824327
MIRT656460	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT656459	hsa-miR-1234-3p	HITS-CLIP	23824327
MIRT656458	hsa-miR-7107-5p	HITS-CLIP	23824327
MIRT656457	hsa-miR-4680-5p	HITS-CLIP	23824327
MIRT656456	hsa-miR-4454	HITS-CLIP	23824327
MIRT006424	hsa-miR-141-3p	HITS-CLIP	23824327
MIRT006423	hsa-miR-200a-3p	HITS-CLIP	23824327
MIRT614933	hsa-miR-6757-3p	HITS-CLIP	23824327
MIRT614932	hsa-miR-3164	HITS-CLIP	23824327
MIRT614931	hsa-miR-6820-3p	HITS-CLIP	23824327
MIRT006424	hsa-miR-141-3p	HITS-CLIP	23824327
MIRT006423	hsa-miR-200a-3p	HITS-CLIP	23824327
MIRT614933	hsa-miR-6757-3p	HITS-CLIP	23824327
MIRT614932	hsa-miR-3164	HITS-CLIP	23824327
MIRT614931	hsa-miR-6820-3p	HITS-CLIP	23824327
MIRT006424	hsa-miR-141-3p	HITS-CLIP	23824327
MIRT006423	hsa-miR-200a-3p	HITS-CLIP	23824327
MIRT614933	hsa-miR-6757-3p	HITS-CLIP	23824327
MIRT614932	hsa-miR-3164	HITS-CLIP	23824327
MIRT614931	hsa-miR-6820-3p	HITS-CLIP	23824327
MIRT536144	hsa-miR-548e-5p	PAR-CLIP	22012620
MIRT536143	hsa-miR-1183	PAR-CLIP	22012620
MIRT536142	hsa-miR-6760-3p	PAR-CLIP	22012620
MIRT536141	hsa-miR-1208	PAR-CLIP	22012620
MIRT536139	hsa-miR-3137	PAR-CLIP	22012620
MIRT536140	hsa-miR-6773-3p	PAR-CLIP	22012620
MIRT536138	hsa-miR-215-3p	PAR-CLIP	22012620
MIRT536137	hsa-miR-2682-3p	PAR-CLIP	22012620
MIRT536136	hsa-miR-6781-3p	PAR-CLIP	22012620
MIRT536135	hsa-miR-668-3p	PAR-CLIP	22012620
MIRT536134	hsa-miR-585-5p	PAR-CLIP	22012620
MIRT536133	hsa-miR-6836-3p	PAR-CLIP	22012620
MIRT536132	hsa-miR-4774-3p	PAR-CLIP	22012620
MIRT536131	hsa-miR-3152-5p	PAR-CLIP	22012620
MIRT168650	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT168651	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT053435	hsa-miR-155-5p	Luciferase reporter assay	25535908
MIRT731592	hsa-miR-27a-3p	LacZ reporter assay	27165190
MIRT731592	hsa-miR-27a-3p	LacZ reporter assay	27165190
MIRT731991	hsa-miR-125a-5p	Luciferase reporter assay	28386337
MIRT731991	hsa-miR-125a-5p	Luciferase reporter assay	28386337
MIRT667461	hsa-miR-1250-3p	HITS-CLIP	27418678
MIRT667460	hsa-miR-153-5p	HITS-CLIP	27418678
MIRT675816	hsa-miR-335-3p	HITS-CLIP	27418678
MIRT675818	hsa-miR-5696	HITS-CLIP	27418678
MIRT667450	hsa-miR-579-3p	HITS-CLIP	27418678
MIRT667449	hsa-miR-664b-3p	HITS-CLIP	27418678
MIRT734408	hsa-miR-22-3p	Luciferase reporter assayqRT-PCRWestern blotting	33986857
MIRT734408	hsa-miR-22-3p	Luciferase reporter assayqRT-PCRWestern blotting	33986857
MIRT736429	hsa-miR-491-3p	qRT-PCRFlow cytometry	33679688
MIRT736430	hsa-miR-491-3p	qRT-PCRFlow cytometry	33679688
MIRT724877	hsa-miR-590-3p	HITS-CLIP	19536157
MIRT724876	hsa-miR-4735-5p	HITS-CLIP	19536157
MIRT724875	hsa-miR-643	HITS-CLIP	19536157
MIRT724874	hsa-miR-6831-3p	HITS-CLIP	19536157
MIRT724873	hsa-miR-4775	HITS-CLIP	19536157
MIRT724872	hsa-miR-7159-3p	HITS-CLIP	19536157
MIRT724871	hsa-miR-4482-3p	HITS-CLIP	19536157
MIRT715172	hsa-miR-181a-2-3p	HITS-CLIP	19536157
MIRT715171	hsa-miR-205-5p	HITS-CLIP	19536157
MIRT715170	hsa-miR-4252	HITS-CLIP	19536157
MIRT715169	hsa-miR-513b-5p	HITS-CLIP	19536157
MIRT715168	hsa-miR-4279	HITS-CLIP	19536157
MIRT715167	hsa-miR-3064-3p	HITS-CLIP	19536157
MIRT715166	hsa-miR-4715-3p	HITS-CLIP	19536157
MIRT715165	hsa-miR-629-3p	HITS-CLIP	19536157
MIRT667461	hsa-miR-1250-3p	HITS-CLIP	23824327
MIRT667460	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT675820	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT675819	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT667459	hsa-miR-4469	HITS-CLIP	23824327
MIRT667458	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT667457	hsa-miR-4287	HITS-CLIP	23824327
MIRT667456	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT667455	hsa-miR-1267	HITS-CLIP	23824327
MIRT667454	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT667452	hsa-miR-4294	HITS-CLIP	23824327
MIRT667453	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT667451	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT675818	hsa-miR-5696	HITS-CLIP	23824327
MIRT667450	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT667449	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT675817	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT667448	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT667447	hsa-miR-3672	HITS-CLIP	23824327
MIRT667446	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT667445	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT667444	hsa-miR-8055	HITS-CLIP	23824327
MIRT675816	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT667443	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT667461	hsa-miR-1250-3p	HITS-CLIP	23824327
MIRT667460	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT667459	hsa-miR-4469	HITS-CLIP	23824327
MIRT667458	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT667457	hsa-miR-4287	HITS-CLIP	23824327
MIRT667456	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT667455	hsa-miR-1267	HITS-CLIP	23824327
MIRT667454	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT667452	hsa-miR-4294	HITS-CLIP	23824327
MIRT667453	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT667451	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT667450	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT667449	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT667448	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT667447	hsa-miR-3672	HITS-CLIP	23824327
MIRT667446	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT667445	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT667444	hsa-miR-8055	HITS-CLIP	23824327
MIRT667443	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT006424	hsa-miR-141-3p	HITS-CLIP	23824327
MIRT006423	hsa-miR-200a-3p	HITS-CLIP	23824327
MIRT614933	hsa-miR-6757-3p	HITS-CLIP	23824327
MIRT614932	hsa-miR-3164	HITS-CLIP	23824327
MIRT614931	hsa-miR-6820-3p	HITS-CLIP	23824327
MIRT656466	hsa-miR-34b-3p	HITS-CLIP	23824327
MIRT656465	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT656464	hsa-miR-4719	HITS-CLIP	23824327
MIRT656463	hsa-miR-548aw	HITS-CLIP	23824327
MIRT168656	hsa-miR-518a-5p	HITS-CLIP	23824327
MIRT168657	hsa-miR-527	HITS-CLIP	23824327
MIRT656462	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT656461	hsa-miR-764	HITS-CLIP	23824327
MIRT656460	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT656459	hsa-miR-1234-3p	HITS-CLIP	23824327
MIRT656458	hsa-miR-7107-5p	HITS-CLIP	23824327
MIRT656457	hsa-miR-4680-5p	HITS-CLIP	23824327
MIRT656456	hsa-miR-4454	HITS-CLIP	23824327
MIRT006424	hsa-miR-141-3p	HITS-CLIP	23824327
MIRT006423	hsa-miR-200a-3p	HITS-CLIP	23824327
MIRT614933	hsa-miR-6757-3p	HITS-CLIP	23824327
MIRT614932	hsa-miR-3164	HITS-CLIP	23824327
MIRT614931	hsa-miR-6820-3p	HITS-CLIP	23824327
MIRT006424	hsa-miR-141-3p	HITS-CLIP	23824327
MIRT006423	hsa-miR-200a-3p	HITS-CLIP	23824327
MIRT614933	hsa-miR-6757-3p	HITS-CLIP	23824327
MIRT614932	hsa-miR-3164	HITS-CLIP	23824327
MIRT614931	hsa-miR-6820-3p	HITS-CLIP	23824327
MIRT006424	hsa-miR-141-3p	HITS-CLIP	23824327
MIRT006423	hsa-miR-200a-3p	HITS-CLIP	23824327
MIRT614933	hsa-miR-6757-3p	HITS-CLIP	23824327
MIRT614932	hsa-miR-3164	HITS-CLIP	23824327
MIRT614931	hsa-miR-6820-3p	HITS-CLIP	23824327
MIRT536144	hsa-miR-548e-5p	PAR-CLIP	22012620
MIRT536143	hsa-miR-1183	PAR-CLIP	22012620
MIRT536142	hsa-miR-6760-3p	PAR-CLIP	22012620
MIRT536141	hsa-miR-1208	PAR-CLIP	22012620
MIRT536139	hsa-miR-3137	PAR-CLIP	22012620
MIRT536140	hsa-miR-6773-3p	PAR-CLIP	22012620
MIRT536138	hsa-miR-215-3p	PAR-CLIP	22012620
MIRT536137	hsa-miR-2682-3p	PAR-CLIP	22012620
MIRT536136	hsa-miR-6781-3p	PAR-CLIP	22012620
MIRT536135	hsa-miR-668-3p	PAR-CLIP	22012620
MIRT536134	hsa-miR-585-5p	PAR-CLIP	22012620
MIRT536133	hsa-miR-6836-3p	PAR-CLIP	22012620
MIRT536132	hsa-miR-4774-3p	PAR-CLIP	22012620
MIRT536131	hsa-miR-3152-5p	PAR-CLIP	22012620
MIRT002950	hsa-miR-24-3p	Luciferase reporter assayWestern blottingqRT-PCRImmunohistochemistry (IHC)Immunofluorescence	33400013
MIRT006423	hsa-miR-200a-3p	Luciferase reporter assayWestern blottingqRT-PCR	35755441
MIRT1130395	hsa-miR-1206	CLIP-seq
MIRT1130396	hsa-miR-141	CLIP-seq
MIRT1130397	hsa-miR-200a	CLIP-seq
MIRT1130398	hsa-miR-2115	CLIP-seq
MIRT1130399	hsa-miR-23a	CLIP-seq
MIRT1130400	hsa-miR-23b	CLIP-seq
MIRT1130401	hsa-miR-23c	CLIP-seq
MIRT1130402	hsa-miR-299-3p	CLIP-seq
MIRT1130403	hsa-miR-3180-5p	CLIP-seq
MIRT1130404	hsa-miR-3918	CLIP-seq
MIRT1130405	hsa-miR-3920	CLIP-seq
MIRT1130406	hsa-miR-433	CLIP-seq
MIRT1130407	hsa-miR-4480	CLIP-seq
MIRT1130408	hsa-miR-4491	CLIP-seq
MIRT1130409	hsa-miR-4512	CLIP-seq
MIRT1130410	hsa-miR-4645-5p	CLIP-seq
MIRT1130411	hsa-miR-4657	CLIP-seq
MIRT1130412	hsa-miR-4673	CLIP-seq
MIRT1130413	hsa-miR-4685-5p	CLIP-seq
MIRT1130414	hsa-miR-4733-3p	CLIP-seq
MIRT1130415	hsa-miR-5096	CLIP-seq
MIRT1130416	hsa-miR-520a-5p	CLIP-seq
MIRT1130417	hsa-miR-525-5p	CLIP-seq
MIRT1130418	hsa-miR-1179	CLIP-seq
MIRT1130419	hsa-miR-1185	CLIP-seq
MIRT1130395	hsa-miR-1206	CLIP-seq
MIRT1130420	hsa-miR-1227	CLIP-seq
MIRT1130421	hsa-miR-1231	CLIP-seq
MIRT1130422	hsa-miR-125b	CLIP-seq
MIRT1130423	hsa-miR-1280	CLIP-seq
MIRT1130424	hsa-miR-130a	CLIP-seq
MIRT1130425	hsa-miR-130b	CLIP-seq
MIRT1130396	hsa-miR-141	CLIP-seq
MIRT1130426	hsa-miR-146a	CLIP-seq
MIRT1130427	hsa-miR-146b-5p	CLIP-seq
MIRT1130428	hsa-miR-1973	CLIP-seq
MIRT1130429	hsa-miR-19a	CLIP-seq
MIRT1130430	hsa-miR-19b	CLIP-seq
MIRT1130397	hsa-miR-200a	CLIP-seq
MIRT1130398	hsa-miR-2115	CLIP-seq
MIRT1130399	hsa-miR-23a	CLIP-seq
MIRT1130400	hsa-miR-23b	CLIP-seq
MIRT1130401	hsa-miR-23c	CLIP-seq
MIRT1130402	hsa-miR-299-3p	CLIP-seq
MIRT1130431	hsa-miR-300	CLIP-seq
MIRT1130432	hsa-miR-301a	CLIP-seq
MIRT1130433	hsa-miR-301b	CLIP-seq
MIRT1130434	hsa-miR-3124-3p	CLIP-seq
MIRT1130435	hsa-miR-3136-3p	CLIP-seq
MIRT1130436	hsa-miR-3145-3p	CLIP-seq
MIRT1130437	hsa-miR-3156-5p	CLIP-seq
MIRT1130438	hsa-miR-3175	CLIP-seq
MIRT1130403	hsa-miR-3180-5p	CLIP-seq
MIRT1130439	hsa-miR-3200-5p	CLIP-seq
MIRT1130440	hsa-miR-328	CLIP-seq
MIRT1130441	hsa-miR-337-3p	CLIP-seq
MIRT1130442	hsa-miR-338-5p	CLIP-seq
MIRT1130443	hsa-miR-34b	CLIP-seq
MIRT1130444	hsa-miR-3605-5p	CLIP-seq
MIRT1130445	hsa-miR-3660	CLIP-seq
MIRT1130446	hsa-miR-3666	CLIP-seq
MIRT1130447	hsa-miR-3671	CLIP-seq
MIRT1130448	hsa-miR-3679-5p	CLIP-seq
MIRT1130449	hsa-miR-3685	CLIP-seq
MIRT1130450	hsa-miR-3688-3p	CLIP-seq
MIRT1130451	hsa-miR-371-5p	CLIP-seq
MIRT1130452	hsa-miR-371b-5p	CLIP-seq
MIRT1130453	hsa-miR-381	CLIP-seq
MIRT1130454	hsa-miR-3913-3p	CLIP-seq
MIRT1130405	hsa-miR-3920	CLIP-seq
MIRT1130455	hsa-miR-4251	CLIP-seq
MIRT1130456	hsa-miR-4261	CLIP-seq
MIRT1130457	hsa-miR-4288	CLIP-seq
MIRT1130458	hsa-miR-4291	CLIP-seq
MIRT1130459	hsa-miR-4295	CLIP-seq
MIRT1130460	hsa-miR-4310	CLIP-seq
MIRT1130461	hsa-miR-4318	CLIP-seq
MIRT1130462	hsa-miR-4319	CLIP-seq
MIRT1130463	hsa-miR-4329	CLIP-seq
MIRT1130406	hsa-miR-433	CLIP-seq
MIRT1130464	hsa-miR-4438	CLIP-seq
MIRT1130465	hsa-miR-4449	CLIP-seq
MIRT1130466	hsa-miR-4477b	CLIP-seq
MIRT1130407	hsa-miR-4480	CLIP-seq
MIRT1130408	hsa-miR-4491	CLIP-seq
MIRT1130467	hsa-miR-4526	CLIP-seq
MIRT1130468	hsa-miR-454	CLIP-seq
MIRT1130410	hsa-miR-4645-5p	CLIP-seq
MIRT1130469	hsa-miR-4648	CLIP-seq
MIRT1130470	hsa-miR-4654	CLIP-seq
MIRT1130411	hsa-miR-4657	CLIP-seq
MIRT1130471	hsa-miR-4659a-3p	CLIP-seq
MIRT1130472	hsa-miR-4659b-3p	CLIP-seq
MIRT1130473	hsa-miR-4666-3p	CLIP-seq
MIRT1130474	hsa-miR-4671-3p	CLIP-seq
MIRT1130475	hsa-miR-4672	CLIP-seq
MIRT1130412	hsa-miR-4673	CLIP-seq
MIRT1130476	hsa-miR-4699-3p	CLIP-seq
MIRT1130477	hsa-miR-4716-3p	CLIP-seq
MIRT1130478	hsa-miR-4717-3p	CLIP-seq
MIRT1130479	hsa-miR-4723-5p	CLIP-seq
MIRT1130480	hsa-miR-4758-3p	CLIP-seq
MIRT1130481	hsa-miR-4761-5p	CLIP-seq
MIRT1130482	hsa-miR-4766-5p	CLIP-seq
MIRT1130483	hsa-miR-4768-3p	CLIP-seq
MIRT1130484	hsa-miR-4768-5p	CLIP-seq
MIRT1130485	hsa-miR-4769-5p	CLIP-seq
MIRT1130486	hsa-miR-488	CLIP-seq
MIRT1130487	hsa-miR-489	CLIP-seq
MIRT1130488	hsa-miR-494	CLIP-seq
MIRT1130489	hsa-miR-502-5p	CLIP-seq
MIRT1130490	hsa-miR-513a-5p	CLIP-seq
MIRT1130491	hsa-miR-513c	CLIP-seq
MIRT1130492	hsa-miR-514b-5p	CLIP-seq
MIRT1130493	hsa-miR-515-5p	CLIP-seq
MIRT1130416	hsa-miR-520a-5p	CLIP-seq
MIRT1130494	hsa-miR-520d-5p	CLIP-seq
MIRT1130495	hsa-miR-524-5p	CLIP-seq
MIRT1130417	hsa-miR-525-5p	CLIP-seq
MIRT1130496	hsa-miR-544b	CLIP-seq
MIRT1130497	hsa-miR-545	CLIP-seq
MIRT1130498	hsa-miR-548ad	CLIP-seq
MIRT1130499	hsa-miR-548al	CLIP-seq
MIRT1130500	hsa-miR-556-3p	CLIP-seq
MIRT1130501	hsa-miR-570	CLIP-seq
MIRT1130502	hsa-miR-582-5p	CLIP-seq
MIRT1130503	hsa-miR-589	CLIP-seq
MIRT1130504	hsa-miR-607	CLIP-seq
MIRT1130505	hsa-miR-615-5p	CLIP-seq
MIRT1130506	hsa-miR-632	CLIP-seq
MIRT1130507	hsa-miR-942	CLIP-seq
MIRT1130421	hsa-miR-1231	CLIP-seq
MIRT1130445	hsa-miR-3660	CLIP-seq
MIRT1130454	hsa-miR-3913-3p	CLIP-seq
MIRT1130457	hsa-miR-4288	CLIP-seq
MIRT1130467	hsa-miR-4526	CLIP-seq
MIRT1130487	hsa-miR-489	CLIP-seq
MIRT1130506	hsa-miR-632	CLIP-seq
MIRT1130396	hsa-miR-141	CLIP-seq
MIRT1130397	hsa-miR-200a	CLIP-seq
MIRT2037155	hsa-miR-1178	CLIP-seq
MIRT1130419	hsa-miR-1185	CLIP-seq
MIRT1130395	hsa-miR-1206	CLIP-seq
MIRT1130421	hsa-miR-1231	CLIP-seq
MIRT1130422	hsa-miR-125b	CLIP-seq
MIRT2037156	hsa-miR-1279	CLIP-seq
MIRT2037157	hsa-miR-1286	CLIP-seq
MIRT1130396	hsa-miR-141	CLIP-seq
MIRT1130429	hsa-miR-19a	CLIP-seq
MIRT1130430	hsa-miR-19b	CLIP-seq
MIRT1130397	hsa-miR-200a	CLIP-seq
MIRT1130398	hsa-miR-2115	CLIP-seq
MIRT2037158	hsa-miR-216b	CLIP-seq
MIRT2037159	hsa-miR-224	CLIP-seq
MIRT2037160	hsa-miR-2276	CLIP-seq
MIRT2037161	hsa-miR-2278	CLIP-seq
MIRT1130402	hsa-miR-299-3p	CLIP-seq
MIRT2037162	hsa-miR-3126-5p	CLIP-seq
MIRT2037163	hsa-miR-3127-3p	CLIP-seq
MIRT2037164	hsa-miR-3140-5p	CLIP-seq
MIRT1130436	hsa-miR-3145-3p	CLIP-seq
MIRT2037165	hsa-miR-3163	CLIP-seq
MIRT1130403	hsa-miR-3180-5p	CLIP-seq
MIRT1130440	hsa-miR-328	CLIP-seq
MIRT1130441	hsa-miR-337-3p	CLIP-seq
MIRT1130443	hsa-miR-34b	CLIP-seq
MIRT2037166	hsa-miR-34c-3p	CLIP-seq
MIRT1130444	hsa-miR-3605-5p	CLIP-seq
MIRT2037167	hsa-miR-3607-3p	CLIP-seq
MIRT1130445	hsa-miR-3660	CLIP-seq
MIRT1130447	hsa-miR-3671	CLIP-seq
MIRT1130448	hsa-miR-3679-5p	CLIP-seq
MIRT2037168	hsa-miR-3686	CLIP-seq
MIRT2037169	hsa-miR-375	CLIP-seq
MIRT2037170	hsa-miR-377	CLIP-seq
MIRT1130454	hsa-miR-3913-3p	CLIP-seq
MIRT1130404	hsa-miR-3918	CLIP-seq
MIRT1130405	hsa-miR-3920	CLIP-seq
MIRT2037171	hsa-miR-4282	CLIP-seq
MIRT1130457	hsa-miR-4288	CLIP-seq
MIRT1130458	hsa-miR-4291	CLIP-seq
MIRT1130462	hsa-miR-4319	CLIP-seq
MIRT1130406	hsa-miR-433	CLIP-seq
MIRT2037172	hsa-miR-4419a	CLIP-seq
MIRT2037173	hsa-miR-4420	CLIP-seq
MIRT2037174	hsa-miR-4422	CLIP-seq
MIRT2037175	hsa-miR-4436a	CLIP-seq
MIRT1130464	hsa-miR-4438	CLIP-seq
MIRT1130407	hsa-miR-4480	CLIP-seq
MIRT1130408	hsa-miR-4491	CLIP-seq
MIRT2037176	hsa-miR-4496	CLIP-seq
MIRT2037177	hsa-miR-450b-3p	CLIP-seq
MIRT2037178	hsa-miR-4510	CLIP-seq
MIRT1130409	hsa-miR-4512	CLIP-seq
MIRT2037179	hsa-miR-451b	CLIP-seq
MIRT1130467	hsa-miR-4526	CLIP-seq
MIRT2037180	hsa-miR-4639-3p	CLIP-seq
MIRT2037181	hsa-miR-4640-3p	CLIP-seq
MIRT2037182	hsa-miR-4643	CLIP-seq
MIRT1130410	hsa-miR-4645-5p	CLIP-seq
MIRT2037183	hsa-miR-4652-3p	CLIP-seq
MIRT1130470	hsa-miR-4654	CLIP-seq
MIRT1130411	hsa-miR-4657	CLIP-seq
MIRT1130475	hsa-miR-4672	CLIP-seq
MIRT1130412	hsa-miR-4673	CLIP-seq
MIRT2037184	hsa-miR-4679	CLIP-seq
MIRT1130413	hsa-miR-4685-5p	CLIP-seq
MIRT2037185	hsa-miR-4696	CLIP-seq
MIRT2037186	hsa-miR-4709-3p	CLIP-seq
MIRT2037187	hsa-miR-4713-3p	CLIP-seq
MIRT1130478	hsa-miR-4717-3p	CLIP-seq
MIRT1130414	hsa-miR-4733-3p	CLIP-seq
MIRT2037188	hsa-miR-4760-3p	CLIP-seq
MIRT1130484	hsa-miR-4768-5p	CLIP-seq
MIRT1130485	hsa-miR-4769-5p	CLIP-seq
MIRT2037189	hsa-miR-4772-3p	CLIP-seq
MIRT2037190	hsa-miR-4802-5p	CLIP-seq
MIRT2037191	hsa-miR-486-5p	CLIP-seq
MIRT1130487	hsa-miR-489	CLIP-seq
MIRT1130490	hsa-miR-513a-5p	CLIP-seq
MIRT1130493	hsa-miR-515-5p	CLIP-seq
MIRT1130416	hsa-miR-520a-5p	CLIP-seq
MIRT1130494	hsa-miR-520d-5p	CLIP-seq
MIRT1130495	hsa-miR-524-5p	CLIP-seq
MIRT1130417	hsa-miR-525-5p	CLIP-seq
MIRT1130496	hsa-miR-544b	CLIP-seq
MIRT1130499	hsa-miR-548al	CLIP-seq
MIRT1130500	hsa-miR-556-3p	CLIP-seq
MIRT1130502	hsa-miR-582-5p	CLIP-seq
MIRT1130504	hsa-miR-607	CLIP-seq
MIRT1130506	hsa-miR-632	CLIP-seq
MIRT2037192	hsa-miR-638	CLIP-seq
MIRT2037193	hsa-miR-646	CLIP-seq
MIRT2037194	hsa-miR-765	CLIP-seq
MIRT2037195	hsa-miR-769-3p	CLIP-seq
MIRT1130507	hsa-miR-942	CLIP-seq
MIRT1130421	hsa-miR-1231	CLIP-seq
MIRT2267197	hsa-miR-124	CLIP-seq
MIRT2037157	hsa-miR-1286	CLIP-seq
MIRT1130424	hsa-miR-130a	CLIP-seq
MIRT1130425	hsa-miR-130b	CLIP-seq
MIRT1130396	hsa-miR-141	CLIP-seq
MIRT1130426	hsa-miR-146a	CLIP-seq
MIRT1130427	hsa-miR-146b-5p	CLIP-seq
MIRT1130429	hsa-miR-19a	CLIP-seq
MIRT1130430	hsa-miR-19b	CLIP-seq
MIRT1130397	hsa-miR-200a	CLIP-seq
MIRT2037161	hsa-miR-2278	CLIP-seq
MIRT1130431	hsa-miR-300	CLIP-seq
MIRT1130432	hsa-miR-301a	CLIP-seq
MIRT1130433	hsa-miR-301b	CLIP-seq
MIRT2037164	hsa-miR-3140-5p	CLIP-seq
MIRT1130437	hsa-miR-3156-5p	CLIP-seq
MIRT1130439	hsa-miR-3200-5p	CLIP-seq
MIRT1130441	hsa-miR-337-3p	CLIP-seq
MIRT1130443	hsa-miR-34b	CLIP-seq
MIRT2267198	hsa-miR-3616-5p	CLIP-seq
MIRT2267199	hsa-miR-3647-5p	CLIP-seq
MIRT1130445	hsa-miR-3660	CLIP-seq
MIRT1130446	hsa-miR-3666	CLIP-seq
MIRT1130447	hsa-miR-3671	CLIP-seq
MIRT2037168	hsa-miR-3686	CLIP-seq
MIRT2267200	hsa-miR-3689a-5p	CLIP-seq
MIRT2267201	hsa-miR-3689b	CLIP-seq
MIRT2267202	hsa-miR-3689e	CLIP-seq
MIRT2267203	hsa-miR-3689f	CLIP-seq
MIRT2267204	hsa-miR-3714	CLIP-seq
MIRT2037170	hsa-miR-377	CLIP-seq
MIRT1130453	hsa-miR-381	CLIP-seq
MIRT2267205	hsa-miR-3910	CLIP-seq
MIRT1130454	hsa-miR-3913-3p	CLIP-seq
MIRT1130404	hsa-miR-3918	CLIP-seq
MIRT1130405	hsa-miR-3920	CLIP-seq
MIRT2267206	hsa-miR-421	CLIP-seq
MIRT1130455	hsa-miR-4251	CLIP-seq
MIRT1130457	hsa-miR-4288	CLIP-seq
MIRT1130459	hsa-miR-4295	CLIP-seq
MIRT1130463	hsa-miR-4329	CLIP-seq
MIRT2037175	hsa-miR-4436a	CLIP-seq
MIRT1130464	hsa-miR-4438	CLIP-seq
MIRT1130466	hsa-miR-4477b	CLIP-seq
MIRT2037177	hsa-miR-450b-3p	CLIP-seq
MIRT1130409	hsa-miR-4512	CLIP-seq
MIRT2037179	hsa-miR-451b	CLIP-seq
MIRT1130467	hsa-miR-4526	CLIP-seq
MIRT1130468	hsa-miR-454	CLIP-seq
MIRT2037180	hsa-miR-4639-3p	CLIP-seq
MIRT2037183	hsa-miR-4652-3p	CLIP-seq
MIRT1130470	hsa-miR-4654	CLIP-seq
MIRT2267207	hsa-miR-4656	CLIP-seq
MIRT1130471	hsa-miR-4659a-3p	CLIP-seq
MIRT1130472	hsa-miR-4659b-3p	CLIP-seq
MIRT1130474	hsa-miR-4671-3p	CLIP-seq
MIRT1130475	hsa-miR-4672	CLIP-seq
MIRT1130413	hsa-miR-4685-5p	CLIP-seq
MIRT2267208	hsa-miR-4688	CLIP-seq
MIRT2037185	hsa-miR-4696	CLIP-seq
MIRT2037186	hsa-miR-4709-3p	CLIP-seq
MIRT2267209	hsa-miR-4709-5p	CLIP-seq
MIRT2037187	hsa-miR-4713-3p	CLIP-seq
MIRT1130414	hsa-miR-4733-3p	CLIP-seq
MIRT1130484	hsa-miR-4768-5p	CLIP-seq
MIRT1130485	hsa-miR-4769-5p	CLIP-seq
MIRT2267210	hsa-miR-4773	CLIP-seq
MIRT2267211	hsa-miR-4778-5p	CLIP-seq
MIRT2267212	hsa-miR-4786-3p	CLIP-seq
MIRT2267213	hsa-miR-4795-5p	CLIP-seq
MIRT1130487	hsa-miR-489	CLIP-seq
MIRT2267214	hsa-miR-506	CLIP-seq
MIRT1130490	hsa-miR-513a-5p	CLIP-seq
MIRT1130499	hsa-miR-548al	CLIP-seq
MIRT2267215	hsa-miR-573	CLIP-seq
MIRT1130503	hsa-miR-589	CLIP-seq
MIRT1130506	hsa-miR-632	CLIP-seq
MIRT2037192	hsa-miR-638	CLIP-seq
MIRT2037193	hsa-miR-646	CLIP-seq
MIRT2037195	hsa-miR-769-3p	CLIP-seq
MIRT1130507	hsa-miR-942	CLIP-seq
MIRT1130395	hsa-miR-1206	CLIP-seq
MIRT1130429	hsa-miR-19a	CLIP-seq
MIRT1130430	hsa-miR-19b	CLIP-seq
MIRT1130398	hsa-miR-2115	CLIP-seq
MIRT1130403	hsa-miR-3180-5p	CLIP-seq
MIRT2267216	hsa-miR-345	CLIP-seq
MIRT1130454	hsa-miR-3913-3p	CLIP-seq
MIRT2267217	hsa-miR-4256	CLIP-seq
MIRT1130407	hsa-miR-4480	CLIP-seq
MIRT1130484	hsa-miR-4768-5p	CLIP-seq
MIRT1130487	hsa-miR-489	CLIP-seq
MIRT1130416	hsa-miR-520a-5p	CLIP-seq
MIRT1130417	hsa-miR-525-5p	CLIP-seq
MIRT2037193	hsa-miR-646	CLIP-seq
MIRT1130422	hsa-miR-125b	CLIP-seq
MIRT2037157	hsa-miR-1286	CLIP-seq
MIRT2390590	hsa-miR-1291	CLIP-seq
MIRT1130396	hsa-miR-141	CLIP-seq
MIRT1130429	hsa-miR-19a	CLIP-seq
MIRT1130430	hsa-miR-19b	CLIP-seq
MIRT1130397	hsa-miR-200a	CLIP-seq
MIRT2390591	hsa-miR-22	CLIP-seq
MIRT2037161	hsa-miR-2278	CLIP-seq
MIRT1130402	hsa-miR-299-3p	CLIP-seq
MIRT2037162	hsa-miR-3126-5p	CLIP-seq
MIRT2037164	hsa-miR-3140-5p	CLIP-seq
MIRT1130403	hsa-miR-3180-5p	CLIP-seq
MIRT1130440	hsa-miR-328	CLIP-seq
MIRT2037166	hsa-miR-34c-3p	CLIP-seq
MIRT2390592	hsa-miR-3667-5p	CLIP-seq
MIRT1130447	hsa-miR-3671	CLIP-seq
MIRT1130454	hsa-miR-3913-3p	CLIP-seq
MIRT1130404	hsa-miR-3918	CLIP-seq
MIRT1130462	hsa-miR-4319	CLIP-seq
MIRT2037172	hsa-miR-4419a	CLIP-seq
MIRT2037175	hsa-miR-4436a	CLIP-seq
MIRT1130407	hsa-miR-4480	CLIP-seq
MIRT1130408	hsa-miR-4491	CLIP-seq
MIRT2037178	hsa-miR-4510	CLIP-seq
MIRT1130409	hsa-miR-4512	CLIP-seq
MIRT2037179	hsa-miR-451b	CLIP-seq
MIRT2390593	hsa-miR-4640-5p	CLIP-seq
MIRT1130411	hsa-miR-4657	CLIP-seq
MIRT1130413	hsa-miR-4685-5p	CLIP-seq
MIRT2037185	hsa-miR-4696	CLIP-seq
MIRT2037186	hsa-miR-4709-3p	CLIP-seq
MIRT1130478	hsa-miR-4717-3p	CLIP-seq
MIRT2390594	hsa-miR-4726-5p	CLIP-seq
MIRT1130414	hsa-miR-4733-3p	CLIP-seq
MIRT1130487	hsa-miR-489	CLIP-seq
MIRT1130493	hsa-miR-515-5p	CLIP-seq
MIRT1130416	hsa-miR-520a-5p	CLIP-seq
MIRT1130417	hsa-miR-525-5p	CLIP-seq
MIRT2390595	hsa-miR-541	CLIP-seq
MIRT1130496	hsa-miR-544b	CLIP-seq
MIRT2390596	hsa-miR-552	CLIP-seq
MIRT2037193	hsa-miR-646	CLIP-seq
MIRT2390597	hsa-miR-654-5p	CLIP-seq
MIRT1130429	hsa-miR-19a	CLIP-seq
MIRT1130430	hsa-miR-19b	CLIP-seq
MIRT1130402	hsa-miR-299-3p	CLIP-seq
MIRT1130408	hsa-miR-4491	CLIP-seq
MIRT1130411	hsa-miR-4657	CLIP-seq
MIRT1130478	hsa-miR-4717-3p	CLIP-seq
MIRT1130500	hsa-miR-556-3p	CLIP-seq
MIRT1130429	hsa-miR-19a	CLIP-seq
MIRT1130430	hsa-miR-19b	CLIP-seq
MIRT2566997	hsa-miR-1276	CLIP-seq
MIRT2037157	hsa-miR-1286	CLIP-seq
MIRT1130429	hsa-miR-19a	CLIP-seq
MIRT1130430	hsa-miR-19b	CLIP-seq
MIRT2037158	hsa-miR-216b	CLIP-seq
MIRT2037160	hsa-miR-2276	CLIP-seq
MIRT2037161	hsa-miR-2278	CLIP-seq
MIRT2566998	hsa-miR-24	CLIP-seq
MIRT2037163	hsa-miR-3127-3p	CLIP-seq
MIRT2566999	hsa-miR-3668	CLIP-seq
MIRT1130447	hsa-miR-3671	CLIP-seq
MIRT2037168	hsa-miR-3686	CLIP-seq
MIRT2567000	hsa-miR-4311	CLIP-seq
MIRT2037175	hsa-miR-4436a	CLIP-seq
MIRT2037176	hsa-miR-4496	CLIP-seq
MIRT2037179	hsa-miR-451b	CLIP-seq
MIRT2037180	hsa-miR-4639-3p	CLIP-seq
MIRT2037181	hsa-miR-4640-3p	CLIP-seq
MIRT2037183	hsa-miR-4652-3p	CLIP-seq
MIRT1130475	hsa-miR-4672	CLIP-seq
MIRT2037185	hsa-miR-4696	CLIP-seq
MIRT2567001	hsa-miR-4698	CLIP-seq
MIRT2037189	hsa-miR-4772-3p	CLIP-seq
MIRT2267210	hsa-miR-4773	CLIP-seq
MIRT2037190	hsa-miR-4802-5p	CLIP-seq
MIRT1130494	hsa-miR-520d-5p	CLIP-seq
MIRT1130495	hsa-miR-524-5p	CLIP-seq
MIRT1130500	hsa-miR-556-3p	CLIP-seq
MIRT2567002	hsa-miR-583	CLIP-seq
MIRT2037193	hsa-miR-646	CLIP-seq
MIRT2037194	hsa-miR-765	CLIP-seq
MIRT2037157	hsa-miR-1286	CLIP-seq
MIRT1130429	hsa-miR-19a	CLIP-seq
MIRT1130430	hsa-miR-19b	CLIP-seq
MIRT2037161	hsa-miR-2278	CLIP-seq
MIRT1130402	hsa-miR-299-3p	CLIP-seq
MIRT2037163	hsa-miR-3127-3p	CLIP-seq
MIRT2037164	hsa-miR-3140-5p	CLIP-seq
MIRT1130447	hsa-miR-3671	CLIP-seq
MIRT2037168	hsa-miR-3686	CLIP-seq
MIRT1130404	hsa-miR-3918	CLIP-seq
MIRT2684577	hsa-miR-3941	CLIP-seq
MIRT2037175	hsa-miR-4436a	CLIP-seq
MIRT1130408	hsa-miR-4491	CLIP-seq
MIRT2037176	hsa-miR-4496	CLIP-seq
MIRT1130409	hsa-miR-4512	CLIP-seq
MIRT2037179	hsa-miR-451b	CLIP-seq
MIRT2037180	hsa-miR-4639-3p	CLIP-seq
MIRT2037181	hsa-miR-4640-3p	CLIP-seq
MIRT2037182	hsa-miR-4643	CLIP-seq
MIRT2037183	hsa-miR-4652-3p	CLIP-seq
MIRT1130411	hsa-miR-4657	CLIP-seq
MIRT2684578	hsa-miR-466	CLIP-seq
MIRT1130475	hsa-miR-4672	CLIP-seq
MIRT1130413	hsa-miR-4685-5p	CLIP-seq
MIRT2037185	hsa-miR-4696	CLIP-seq
MIRT2037186	hsa-miR-4709-3p	CLIP-seq
MIRT1130478	hsa-miR-4717-3p	CLIP-seq
MIRT2684579	hsa-miR-4731-3p	CLIP-seq
MIRT1130414	hsa-miR-4733-3p	CLIP-seq
MIRT2684580	hsa-miR-4801	CLIP-seq
MIRT2037190	hsa-miR-4802-5p	CLIP-seq
MIRT1130494	hsa-miR-520d-5p	CLIP-seq
MIRT1130495	hsa-miR-524-5p	CLIP-seq
MIRT1130500	hsa-miR-556-3p	CLIP-seq
MIRT2684581	hsa-miR-603	CLIP-seq
MIRT2037193	hsa-miR-646	CLIP-seq
MIRT1130429	hsa-miR-19a	CLIP-seq
MIRT1130430	hsa-miR-19b	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
MEF2A	Activation	18073218

132

Show/Hide all (132)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000077	Process	DNA damage checkpoint signaling	IEA
GO:0000165	Process	MAPK cascade	IEA
GO:0000165	Process	MAPK cascade	ISS
GO:0000166	Function	Nucleotide binding	IEA
GO:0000902	Process	Cell morphogenesis	IEA
GO:0000922	Component	Spindle pole	IEA
GO:0001502	Process	Cartilage condensation	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001890	Process	Placenta development	IEA
GO:0002021	Process	Response to dietary excess	IEA
GO:0002062	Process	Chondrocyte differentiation	IEA
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	TAS
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	EXP	11532965
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	35857590
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004707	Function	MAP kinase activity	IDA	7997261, 10330143, 20932473
GO:0004707	Function	MAP kinase activity	IEA
GO:0004708	Function	MAP kinase kinase activity	TAS	10706854
GO:0005515	Function	Protein binding	IPI	9788880, 9792677, 10601328, 11238443, 16189514, 16751104, 17255097, 17255949, 17380123, 17380128, 18624398, 20347885, 20368287, 20871633, 20936779, 21283629, 21908610, 21988832, 22521293, 23397142, 23455922, 23560844, 23602568, 23932588, 25241761, 25822914, 25852190, 26496610, 27880
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	30878395
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IDA	7535770
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006006	Process	Glucose metabolic process	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	ISS
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006935	Process	Chemotaxis	TAS	10706854
GO:0006974	Process	DNA damage response	IEA
GO:0007165	Process	Signal transduction	TAS	10706854
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	10706854
GO:0007178	Process	Cell surface receptor protein serine/threonine kinase signaling pathway	IEA
GO:0007519	Process	Skeletal muscle tissue development	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IGI	24299952
GO:0010628	Process	Positive regulation of gene expression	IMP	25754930
GO:0010831	Process	Positive regulation of myotube differentiation	IEA
GO:0010831	Process	Positive regulation of myotube differentiation	ISS
GO:0016301	Function	Kinase activity	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0016740	Function	Transferase activity	IEA
GO:0019395	Process	Fatty acid oxidation	IEA
GO:0019899	Function	Enzyme binding	IPI	23483889
GO:0019903	Function	Protein phosphatase binding	IPI	10391943, 21283629
GO:0030168	Process	Platelet activation	TAS
GO:0030278	Process	Regulation of ossification	IEA
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0030316	Process	Osteoclast differentiation	ISS
GO:0031098	Process	Stress-activated protein kinase signaling cascade	IDA	35857590
GO:0031281	Process	Positive regulation of cyclase activity	IMP	22027397
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IEA
GO:0032495	Process	Response to muramyl dipeptide	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032735	Process	Positive regulation of interleukin-12 production	IEA
GO:0032735	Process	Positive regulation of interleukin-12 production	IMP	25754930
GO:0032868	Process	Response to insulin	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0035331	Process	Negative regulation of hippo signaling	IMP	27402810
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IDA	10838079
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IMP	18440775
GO:0035994	Process	Response to muscle stretch	IEA
GO:0038066	Process	P38MAPK cascade	IDA	10330143
GO:0038066	Process	P38MAPK cascade	IEA
GO:0038066	Process	P38MAPK cascade	ISS
GO:0038066	Process	P38MAPK cascade	TAS
GO:0042307	Process	Positive regulation of protein import into nucleus	IEA
GO:0042770	Process	Signal transduction in response to DNA damage	IMP	20160708
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IMP	18440775
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IEA
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IMP	23483889
GO:0045663	Process	Positive regulation of myoblast differentiation	IEA
GO:0045663	Process	Positive regulation of myoblast differentiation	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046323	Process	D-glucose import	IEA
GO:0046326	Process	Positive regulation of D-glucose import	IEA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IMP	18440775
GO:0048273	Function	Mitogen-activated protein kinase p38 binding	IPI	11035004
GO:0048863	Process	Stem cell differentiation	IEA
GO:0051146	Process	Striated muscle cell differentiation	IEA
GO:0051149	Process	Positive regulation of muscle cell differentiation	IEA
GO:0051149	Process	Positive regulation of muscle cell differentiation	TAS
GO:0051403	Process	Stress-activated MAPK cascade	IDA	35857590
GO:0051403	Process	Stress-activated MAPK cascade	IEA
GO:0051525	Function	NFAT protein binding	IEA
GO:0051525	Function	NFAT protein binding	ISS
GO:0051604	Process	Protein maturation	IDA	32109412
GO:0060045	Process	Positive regulation of cardiac muscle cell proliferation	IEA
GO:0060348	Process	Bone development	IEA
GO:0070269	Process	Pyroptotic inflammatory response	IDA	32109412
GO:0070935	Process	3'-UTR-mediated mRNA stabilization	TAS	20932473
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	23776175
GO:0071223	Process	Cellular response to lipoteichoic acid	IMP	26649771
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071479	Process	Cellular response to ionizing radiation	IMP	20160708
GO:0071493	Process	Cellular response to UV-B	IDA	35857590
GO:0071493	Process	Cellular response to UV-B	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090336	Process	Positive regulation of brown fat cell differentiation	IEA
GO:0090398	Process	Cellular senescence	IEA
GO:0090398	Process	Cellular senescence	TAS
GO:0090400	Process	Stress-induced premature senescence	IMP	20160708
GO:0098586	Process	Cellular response to virus	IEA
GO:0098586	Process	Cellular response to virus	IMP	25754930
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099179	Process	Regulation of synaptic membrane adhesion	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1900015	Process	Regulation of cytokine production involved in inflammatory response	IDA	15251176
GO:1901741	Process	Positive regulation of myoblast fusion	IEA
GO:1901741	Process	Positive regulation of myoblast fusion	ISS
GO:1904784	Process	NLRP1 inflammasome complex assembly	IDA	22665479
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IMP	20160708

MIM	HGNC	e!Ensembl
600289	6876	ENSG00000112062

Q16539

Protein name

Mitogen-activated protein kinase 14 (MAP kinase 14) (MAPK 14) (EC 2.7.11.24) (Cytokine suppressive anti-inflammatory drug-binding protein) (CSAID-binding protein) (CSBP) (MAP kinase MXI2) (MAX-interacting protein 2) (Mitogen-activated protein kinase p38 a

Protein function

Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK14 is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli su

PDB

1A9U , 1BL6 , 1BL7 , 1BMK , 1DI9 , 1IAN , 1KV1 , 1KV2 , 1M7Q , 1OUK , 1OUY , 1OVE , 1OZ1 , 1R39 , 1R3C , 1W7H , 1W82 , 1W83 , 1W84 , 1WBN , 1WBO , 1WBS , 1WBT , 1WBV , 1WBW , 1WFC , 1YQJ , 1ZYJ , 1ZZ2 , 1ZZL , 2BAJ , 2BAK , 2BAL , 2BAQ , 2FSL , 2FSM , 2FSO , 2FST , 2GFS , 2I0H , 2LGC , 2NPQ , 2OKR , 2ONL , 2QD9 , 2RG5 , 2RG6 , 2Y8O , 2YIS , 2YIW , 2YIX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	24 → 308	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Brain, heart, placenta, pancreas and skeletal muscle. Expressed to a lesser extent in lung, liver and kidney.

Sequence

MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

Sequence length

360

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (20)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY CIRRHOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS, EXTRAHEPATIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC FOOT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATIC INSUFFICIENCY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTESTINAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, BILIARY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CHOLANGITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY EDEMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYMPTOMS OF DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (601)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acanthosis Nigricans	Acanthosis Nigricans	BEFREE	22585574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Actinic keratosis	Actinic keratosis	BEFREE	29298652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	23349247, 25164947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	29349553, 29484391, 29890468, 30370491, 30718368, 30852771, 31432106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	22354283, 26003841, 29055789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11585739, 25019985, 27775076, 30879017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18541673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	30102978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	21164364, 21858220, 22415779, 28618937, 28900489, 30321617, 30827261, 30879017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	15969750, 17078869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	24409315, 30007963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	28114280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	30298517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	Pubtator	37974207	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	22302101, 22855790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	17950728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	28194256		★★★★★ ★☆☆☆☆ Found in Text Mining only
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	30940726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alexander Disease	Alexander Disease	LHGDN	18276609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	21811019, 28598851, 35697992	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	30233281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	30033276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	28493082, 29282578, 31429590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	14989597, 18312546, 28273913, 29499331, 29789529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	28366453	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	14581411, 28566491, 29216010, 29366902, 31378753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Diamond-Blackfan	Anemia	BEFREE	25270909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	31447579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	30332653	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	28938189, 31456484		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	25426613, 28352075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	31398429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	16385547	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	31638233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	26045772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	29956759, 30905780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Calcification of	Aortic valve disease	Pubtator	33757126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	28437005, 29620252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	17363696, 17957039, 21695272, 27592629, 27871059, 29257205, 29378168, 29566026, 29692651, 29793330, 30486366, 31171272, 31496351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	16043718, 18026701, 22488549, 24107108, 28343998, 29206314, 29291937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	20631726, 24241152, 34576119	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	14695331, 20830230, 28239238, 28259936, 30897288, 31338093, 31791845, 32508836, 33483588, 36660934	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	14730602	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ARTHROGRYPOSIS, DISTAL, TYPE 2B	Sheldon-Hall syndrome	BEFREE	28948356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	14991070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asbestosis	Asbestosis	BEFREE	18314537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asbestosis	Asbestosis	Pubtator	18314537	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	BEFREE	31014201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12641490, 22947346, 26517722, 28402030, 29284473, 29448086, 29554934, 30186353, 30428724, 30511684, 30589094, 31445014, 31602218, 31808595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	15475489, 31808595, 31974640, 35473352	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	22947346	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma, Occupational	Asthma	BEFREE	30244166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	10501211	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11067916, 12191496, 17446059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	14570874, 17396146, 30085341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	26491069	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	17363696, 17957039, 21695272, 27592629, 27871059, 29257205, 29378168, 29566026, 29692651, 29793330, 30486366, 31171272, 31496351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	20404041, 31330988, 37509127, 40708018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	39331874	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atypical Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	34388364	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30297392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	21328587, 23139385, 23190644, 24741615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	2298745, 26095162, 34267747, 9647638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	28493082, 29282578, 31429590		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	15753397, 21092277, 24738081, 28158919, 28272166, 28550734, 28713946, 28849038, 29113197, 29285123, 29434895, 29725459, 30106096, 30106128, 30280789 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	15483673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barber Say syndrome	Barber Say Syndrome	BEFREE	22585574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	16935849, 31984785	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	27880726, 30061836, 31464618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bernard-Soulier Syndrome	Bernard Soulier Syndrome	BEFREE	22585574		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	31789406		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	31789406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	31078518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	CTD_human_DG	30026087		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary Cirrhosis, Primary, 1	Biliary cirrhosis	CTD_human_DG	30026087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	17671727, 19293182, 19424573, 21902544, 22154358, 29154981, 29463565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	31476327	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	22425892, 29637005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Failure Disorders	Bone marrow failure syndromes	Pubtator	18949619	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	11818564, 29382550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	33021050	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	18058803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10766865, 12698197, 12972603, 14745865, 15056732, 16050133, 17214981, 17697330, 17875734, 19279008, 19920204, 20980434, 21099351, 22064321, 22073986 View all (33 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10766865, 11060298, 11606583, 11692142, 11983707, 12377770, 12429732, 12698197, 14597737, 14745865, 15520018, 15753376, 15843433, 16000313, 17332506 View all (38 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brooke-Spiegler syndrome	Brooke-Spiegler Syndrome	BEFREE	22585574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	17237610, 21470196, 24787013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	21470196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	24358176, 33757126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28410196	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	28887603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	29215790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15078869, 18167130, 23035214, 23966163, 24386414, 25886177, 26520689, 26875893, 27431384, 28677801, 29358721, 31786862, 32677672, 34410947, 36123370, 36498978, 37021545 View all (2 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	15753376	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	17115023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	17671727, 19293182, 19424573, 21902544, 22154358, 29154981, 29463565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17609948, 19401523, 21164364, 21885439, 22053010, 22415779, 23333461, 26269117, 26872057, 27026405, 27537399, 27922667, 28460458, 30280780, 30827261, 31428903, 31489665, 31695416 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	34638541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	18254976, 28352075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22493490, 24576174, 26617834, 27806310, 33960011	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	16452230, 23651874	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	22302101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27322208, 30049957, 31301414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	37488545	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	10620750		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	LHGDN	17446930		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	10620750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Alcoholic	Cardiomyopathy	BEFREE	29506687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	29204251, 30099338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	18403595	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30292134, 31494123, 31689891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	26254334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	20955562	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Cavernous Malformations 3	Cerebral Cavernous Malformation	BEFREE	19246713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	30836997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	18545259, 27905005, 30503674, 31389585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	31923616	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Vasospasm	Cerebral Vasospasm	BEFREE	15118180, 30369282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29382550		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	23940799, 30098789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	23940799, 30098789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	22302101, 22855790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	12717393, 16469407, 23024367, 25502636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	30880771, 37056930	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	19187229	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholestasis	Cholestasis	CTD_human_DG	20626112		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholestasis, Extrahepatic	Cholestasis	CTD_human_DG	30026087		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholesteatoma	Cholesteatoma	BEFREE	16639284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	10765924, 23892595, 24047437, 26168133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	16549373, 18340449, 21328612, 26168133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	29206629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Infantile Neurological, Cutaneous, and Articular Syndrome	Neurological, Cutaneous And Articular Syndrome	BEFREE	16279571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	27226108, 30897126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15483673, 16408101, 18288129, 21470196, 26337206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	28237966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	17406066, 20438701, 28214201, 28621371, 29074542, 29566026, 29719383, 30588579, 30860857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	17959643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	19940360	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Classical phenylketonuria	Phenylketonuria	BEFREE	19946178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	22612415	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29467361, 30609815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	16838116, 25533544, 29518435, 31205031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15037631, 16849586, 19845689, 21847367, 22076613, 22155142, 22684547, 23422270, 23859040, 24880666, 29636389, 31364822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17524358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	25890501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	27526785, 34060286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10769637, 15975962, 19343039, 20413844, 23900560, 28376477, 28731192, 28864417, 30211553, 30221676, 30588113, 30864690, 30949407, 31650548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15037631, 19549798, 19845689, 21521691, 21722370, 23799978, 24362252, 24865968, 25056534, 25124618, 26320459, 27195675, 27926494, 28864417, 29152648 View all (17 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18395970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33767160	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	28049487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	11448140, 11593045, 15867183, 19357768, 21271996, 27439062, 27941647, 28100897, 28104751, 30860934, 30864233, 31505169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23935100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	20307495, 30135318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29122645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	33849106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	22585574, 30804419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	11994493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	12223450, 25533544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	19022976	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	15994249, 22466961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	20460375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	18031579, 18223264, 18523305, 20155832, 20830230, 21181091, 25091567, 26873249, 27907835, 28337303, 28744712, 29061447, 29524442, 29682561, 29899528 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	20118172	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	24455679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	21356304, 21810259, 29867510, 31629950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	28106783, 28404919, 29535261, 31378305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	28493082, 29282578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	25912722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	21288594, 29621941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	29088769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental absence of tooth	Anodontia	BEFREE	22612415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12957654, 15145956, 17554073, 28534138, 31794124, 9916130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12957654, 15145956, 17554073, 21478266, 28534138, 28807219, 29523003, 29615288, 31794124, 9916130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	24098138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	16869889, 30593206, 33430853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	26911458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	28672053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17922475, 21892182, 25758573, 28888936, 29663930, 30188871, 30284474, 30981822, 31072439, 31473185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	28672053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	30067872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic Foot	GWASCAT_DG	28672053		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Foot	Diabetic foot	Pubtator	28672053	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	34854210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	15232685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	27226108, 28588674, 28672912, 29207166, 30049003, 30784180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic neuropathy	Pubtator	33430853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	22605924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	36465659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	30446590		★★★★★ ★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Digeorge syndrome	Pubtator	27801899	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	29721975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	31442556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	30119655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	35227068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysphoric mood	Mood Disorder	PSYGENET_DG	17959804		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	26033187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	25912722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	26153023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	24988221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15550066, 24923883, 26394174, 28845752, 30773096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	40037422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Enteritis	Enteritis	BEFREE	20885979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	16792588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Simplex	Epidermolysis bullosa	Pubtator	21490615	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
EPILEPSY, PYRIDOXINE-DEPENDENT	Epilepsy	BEFREE	19801633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	28237815, 28472735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	28188686, 30868916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	30049957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	23107826, 29344159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	23107826, 29344159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	34954212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	27037775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	25502636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	28493083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	22234699		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	22234699		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP C	Fanconi Anemia	BEFREE	28539126		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP F	Fanconi Anemia	BEFREE	22952942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29356058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29335857, 30205811, 30914267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrodysplasia Ossificans Progressiva	Fibrodysplasia Ossificans Progressiva	BEFREE	16753021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	29104242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis of pancreas	Fibrosis Of Pancreas	BEFREE	29705706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	23459070, 29322133, 30700848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	28483380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Friedreich Ataxia	Friedreich Ataxia	BEFREE	29568068		★★★★★ ★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	29568068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	24903309	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	26968576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	BEFREE	29217619, 31751591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	26993769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	22351694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	26312487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease, Type 3 (disorder)	Gaucher Disease	BEFREE	26312487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19894226, 24641279, 24967005, 27036038, 31037147, 32179921, 33021050, 34719645, 35814563, 35836243, 37747443	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22528800, 22901381, 23261467, 24185179, 25088200, 26597532, 26794430, 28012022, 28386317, 29088769, 29316898, 29669288, 30359578, 30639532, 30717309 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22162832, 22528800, 22901381, 23261467, 25088200, 26597532, 26794430, 28012022, 28386317, 29088769, 29316898, 29669288, 30359578, 30639532, 30717309 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	14585987, 17012236, 17442041, 22114076, 23382286, 25152024, 28410196, 30373180, 30556882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	16814421, 16964394, 17442041, 17616668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	17406030, 22114076, 25535908, 27609291, 27658347, 28012022, 28569417, 29316898, 30674294, 30678338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	35172688	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	28483380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	30389788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	21828034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	23474535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	33488522, 33597925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	31548323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome, Familial	Guillain-Barre Syndrome	BEFREE	31548323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	23837874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	22110204, 29983416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	11448140, 11593045, 15867183, 19357768, 21271996, 27941647, 28104751, 30864233, 31505169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	LHGDN	18095520		★★★★★ ★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	19565356, 25583406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	30481789	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	31130074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhagic Disorders	Hemorrhagic Disorders	BEFREE	16786433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	26391982, 28559272	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	26660341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular degeneration	Pubtator	26660341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary and idiopathic neuropathy, unspecified	Hereditary and idiopathic neuropathy	GWASCAT_DG	28672053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	21574647	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	19703193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	18327563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	12107734, 12957654, 19279131, 24720336, 25758573, 26439801, 28731135, 28962618, 29207166, 29421811, 30826930, 31150695, 9916130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	16864945, 19279131, 33328159	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	26930265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	21386087, 30859314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	30651770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperoxaluria	Hyperoxaluria	BEFREE	28185107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	19565356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Portal	Portal hypertension	Pubtator	31934265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	32587469	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	14561851, 27283322, 29566148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	Pubtator	32575434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	28471037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypodontia	Hypodontia	BEFREE	22612415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	29896988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12213726, 17332506, 17456758, 19151763, 28618937, 30816677, 32587469, 35378949	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	16151532, 17099219, 19187229, 23119050, 26045772, 28677369, 30332653, 30634531, 36429023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28910144, 29511490, 30274147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30074215		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	30897126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	30302660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	27283322, 28472735, 29201176, 29467361, 29804103, 30609815, 30695686, 30845718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Incontinentia Pigmenti Achromians	Incontinentia Pigmenti Achromians	BEFREE	28601021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	16838116, 31627210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	20731675	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	28404919, 29535261, 31378305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	20661932, 26911458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	26911458, 33215410	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	26911458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	18239167	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	28241849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	28500782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29663930, 31115561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Jaundice, Obstructive	Jaundice	BEFREE	31810142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	18221537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	17308066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	24040439, 25164947	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	27226108, 29207166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28881633, 29504713, 30511081, 30539653, 30976980, 30991714, 31529146, 31639165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	28352125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	22521293, 33960011, 37047552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	32468011	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10783388, 15328418, 17673311, 18487954, 20836852, 22825467, 35078224, 9202001	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	12473116, 18563362		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15514005, 20053787, 23707387, 23880928, 25684043, 26205966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	25619389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11698483, 15911090, 18487954, 20945381, 27545880, 33253299	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	15273249	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	20164150, 27499693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	17308068, 20543580, 22354283, 25426669, 28137827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	17950728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	23238519		★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	22243975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10445852, 15849811, 16951197, 17483345, 17673262, 18167130, 19497411, 21102517, 21544813, 21732638, 23029478, 23319057, 23929653, 24199952, 25216638 View all (21 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15849811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	19187229, 31141540	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10445852, 16951197, 21732638		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	CTD_human_DG	17468757		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	24382347, 28454121, 29719300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	12584565, 27226640, 28007785, 30867890		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	16410245		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	17468755		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	21507199, 22415779, 24845028, 24988892, 26968871, 28592245, 28618937, 33360044, 36142846, 36864513	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus	Lupus Erythematosus	BEFREE	30268079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	29061842, 36482627	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	30268079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	30268079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	27365897, 30145800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	36335193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	30268079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	18094073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28454121	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	16247482, 22649101, 23153195, 29604597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	23072591	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	12756297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	12756297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	15077178, 26475474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	15077178, 26475474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	15077178, 26475474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	18362077		★★★★★ ★☆☆☆☆ Found in Text Mining only
MACULAR DYSTROPHY, PATTERNED, 3	Macular dystrophy, patterned	BEFREE	27474146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	30180869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	22243975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	17616668, 18245466, 23261452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	22110204, 29983416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10766865, 12698197, 12972603, 15056732, 16050133, 16897432, 17214981, 17697330, 17875734, 19279008, 19920204, 20980434, 21099351, 22064321, 22073986 View all (31 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	23107826, 23722928, 29344159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	17468757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31147803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	17468755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17609948, 19401523, 21164364, 21885439, 22053010, 22415779, 23333461, 26269117, 26872057, 27026405, 27537399, 27922667, 28007785, 28460458, 30280780, 30827261, 31489665, 31695416 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	23238519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27322208, 31301414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	14598883, 24720336, 26439801, 26479921, 27278736, 29340057, 30756419, 31072439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15031672, 16407830, 16437387, 16618780, 16956884, 17531530, 18413810, 23255296, 24080497, 24228091, 24619413, 26913608, 26919443, 28008585, 28213961 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	12370831, 30468479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20066900, 27890795, 29237470, 30011079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	25045295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	17671727, 19293182, 19424573, 21902544, 22154358, 29154981, 29463565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12972603, 16932740, 17292820, 17483345, 18217689, 19852565, 21470196, 21885439, 22106296, 22154358, 22302101, 22522455, 23266613, 23335506, 23403951 View all (34 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	23940799, 30098789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15037631, 16849586, 19845689, 21847367, 22076613, 22155142, 22684547, 23422270, 23859040, 24880666, 29636389, 31364822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12085235, 12698197, 15843433, 17332506, 17612563, 17879955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19920204, 21099351, 24251561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	27893734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	22302101, 22855790		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10871852, 15378016, 18068334, 18983537, 20181932, 29067466, 29276966, 29291012, 30873870, 31401046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11399512, 11571298, 12114539, 24954857, 25138157, 28703746, 31622599, 31661126, 37277447	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12855667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	18616526	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	20181932, 35538545	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	21356304, 29867510, 31629950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	16447244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	17805054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	15830375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	25164947	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	25164947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	20393480, 33381267, 37398680	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	28598851	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	25634589, 29564744, 34769290, 37678860	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muckle-Wells Syndrome	Muckle-Wells Syndrome	BEFREE	16279571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	20600450, 34290221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	30861201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12393542, 17173546, 23360454, 26724804, 29654269, 37033323	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	18593922, 19282458, 20200560, 22425892, 23066034, 30583070, 31777580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	26601950	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	18054783, 21791428, 25737586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	18054783, 26095162	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Facioscapulohumeral	Facioscapulohumeral muscular dystrophy	Pubtator	32576599	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	29723037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	31189728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	16272363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	16204077		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	16204077, 16940419, 22327869, 25480830, 28405919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	16940419, 18949619	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	29670085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	CTD_human_DG	16818652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	17949234, 19324082, 19672773, 21890458, 28133573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	28237966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	10620750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28559372, 28596578, 28713990, 29045288, 29232411, 29434760, 29630131, 29991775, 30116330, 30391964, 31646600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	29197221, 31269974, 35378949	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	11181011, 20307495, 30135318		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	BEFREE	31370111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	33986259	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis Ossificans	Myositis	Pubtator	16753021	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	39529136	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	23406595, 30804419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	20607722, 27596819, 31436393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	31991751, 35463684	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	14600398	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11279018, 12021785, 12972603, 14730602, 15492254, 1560527, 15611662, 15976377, 16010555, 16230412, 16263703, 17028194, 17108114, 17254968, 17346218 View all (59 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	29187369		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30983972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11032891, 11163539, 11598801, 15784962, 15950779, 16484283, 18534018, 19009558, 23507189, 25033461, 25086905, 25148040, 28831692, 30545920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	28134320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30327995, 30735722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	28202578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	GWASCAT_DG	28672053		★★★★★ ★☆☆☆☆ Found in Text Mining only
NEUROPATHY, CONGENITAL HYPOMYELINATING, 2	Neuropathy	GWASCAT_DG	28672053		★★★★★ ★☆☆☆☆ Found in Text Mining only
NEUROPATHY, CONGENITAL HYPOMYELINATING, 3	Neuropathy	GWASCAT_DG	28672053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30908654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10874022, 16705311, 21306997, 22053010, 23456625, 23603895, 24026034, 24292713, 26503828, 26799187, 26993769, 28286419, 28460458, 29110442, 29956791 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	29335857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Norrie disease	Norrie Disease	BEFREE	29575791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	20117442, 25164947	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23632636	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24929539, 25034973, 29317435, 30264458, 31139234, 31553232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	15498796, 18562219, 20955562, 25091567, 31364869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	31077183, 39809203	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	25635827	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	30731111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	35617639	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	19828631, 28343998, 30439432, 30934850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30934850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	32620113, 35069454, 38509680	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	19330880, 22849560, 23262982, 24448647, 26238193, 27799356, 28350136, 29434992, 29607921, 30267330, 30746754, 31268160, 31505816, 31719210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32901836, 36438897	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	25888489	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	17341442, 17611702		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27322208, 31301414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22594559, 23354626, 26824454, 28117030, 28440479, 32021086, 35490254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	25655200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	14598883, 24720336, 26439801, 26479921, 27278736, 29340057, 30756419, 31072439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	16278378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20423995, 21321110, 23694968, 24556918, 26559273, 28352075, 35103981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	25888489	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	31432106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	25231838, 25592304, 30904818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	17592548	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paralysis	Paralysis	Pubtator	24737428	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	19766325	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	12783850, 16049031, 21209210, 28035410, 28365714, 29540778, 29899409, 30071902, 30473884, 30933849, 30995872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	16515547, 28365714	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	BEFREE	28600798, 28928733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	37940861	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	23657501, 28600798, 31218663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	31586635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	26138525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	11181011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	28120492, 29207066, 31599069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	30593206, 36043447	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	30179591, 31387001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	30179591, 31387001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	15698454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	29742502	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Phenylketonurias	Phenylketonuria	BEFREE	19946178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	30007963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	15658002, 15977985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	29168690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	31231308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	28344879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	16797938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	34059095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Posterior subcapsular cataract	Capsular cataract	BEFREE	26010611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	28295194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	CTD_human_DG	30026087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	26010611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15031672, 16407830, 16618780, 16956884, 17531530, 18413810, 19242540, 23255296, 24080497, 24228091, 24619413, 26913608, 26919443, 28008585, 28213961 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	27880726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17196171, 17531530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17325745, 17531530, 19151763, 20168333, 23703386, 25277191, 26913608, 29575464, 30483762, 35595103	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	24863062, 28239238, 28266627, 28602508, 31378305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	28239238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	29049722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	12734193, 17959643, 19004925, 23060629, 24382347, 24988221, 27199554	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	27226108, 30082522, 31071512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	35964659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	23859041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23935100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	22076433, 26919280, 27365897, 29661023, 30127380, 30897126, 31739543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renpenning syndrome 1	Renpenning Syndrome	BEFREE	28948356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Respiratory Distress Syndrome	BEFREE	12819782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	12819782, 29039541, 31411275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	12819782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Restrictive cardiomyopathy	Restrictive cardiomyopathy	BEFREE	11593045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	29408550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	31648555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	14730602, 27642049, 29109039, 29237430, 29790698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	29790698	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	12186945, 29790086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	LHGDN	17519236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Embryonal	Rhabdomyosarcoma	Pubtator	12359053, 35801577	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	LHGDN	18095520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10620700, 11929337, 12641490, 14730602, 15170913, 15557189, 16778989, 16947383, 17530707, 17786275, 19765281, 19828631, 20830230, 22488549, 24574214 View all (14 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	15170913, 16613612		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis Allergic	Rhinitis	Pubtator	37793334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic Seasonal	Seasonal allergic rhinitis	Pubtator	18727065	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	28657795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rothmund-Thomson syndrome	Rothmund-Thomson Syndrome	BEFREE	23001818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	20851927, 27402699	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	15310753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	22243975, 25273173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	22243975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	20877355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	16699017, 17964626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18460190, 20347265, 28035416		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	18460190		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	27801899	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma	Scleroderma	BEFREE	11918720, 16098034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	2298745	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	24578173	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
SCLEROSING CHOLANGITIS, NEONATAL	Sclerosing Cholangitis	BEFREE	30954890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seckel syndrome	Seckel Syndrome	BEFREE	23401567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seckel syndrome 1	Seckel syndrome	Pubtator	23401567	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary Biliary Cholangitis	Biliary Cholangitis	CTD_human_DG	30026087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	15658002, 15977985, 29201176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	25867908, 37398680	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28147298, 29039541, 29227823, 31775794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	17470913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	25148579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	10340964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	LHGDN	12370831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	31585897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	31309463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	30862036	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	31231131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	24722482	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
SMITH-MCCORT DYSPLASIA 1	Smith-McCort Dysplasia	BEFREE	31078518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	BEFREE	28887603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	23656793, 31361024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Autosomal Recessive 2	Spinocerebellar ataxia	Pubtator	18621123	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	27461236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17334397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19584293, 20121928, 31315217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22167332, 22522455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24205072, 25834400, 29564744, 35854245, 36708578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29747487	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	28469797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	20717005, 22110204, 23238519, 24568968, 27531877, 28915597, 29575240, 29747487, 30622052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	29410394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	31331032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28448873, 29356058, 30914267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome Toxic Epidermal Necrolysis Spectrum	Stevens-Johnson Syndrome	BEFREE	28949055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20066900, 27890795, 29237470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15309729, 19091131, 23456298, 24185104, 24838641, 25337202, 25342459, 27431278, 27588146, 31466817, 31983124, 37843333, 38099343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17698513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37537191	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	15118180, 29160895, 30242669, 30369282, 30980845		★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	19737974		★★★★★ ★☆☆☆☆ Found in Text Mining only
SYNOVITIS, GRANULOMATOUS, WITH UVEITIS AND CRANIAL NEUROPATHIES (disorder)	Arthrocutaneouveal granulomatosis	BEFREE	25429073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	11918720, 16098034, 28189565, 30404019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	16098034		★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	28194179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	12581337, 15658002, 15977985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	34059095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	31547619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	37898857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	25045295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	16924234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	25045295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	25045295, 37898857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	35806120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	28194179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	28710025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	19920204, 28674186, 32357907, 34970732	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29777109, 29880481, 30462562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	24988221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	30928642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	26090671, 28667430, 29518435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	18237400, 18825409, 28586028, 29463565, 38072891	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	19010820, 25250801, 25273091, 28673331, 29590661, 31951596, 32196955, 33827480, 35939492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	19299454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	23401649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	15790570, 29061842, 34388364	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	30158835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	31463533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	19207217		★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	19207217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	31069271	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	30173943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	32763516	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	16803993, 20536832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner syndrome	Pubtator	23112078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma pigmentosum	Pubtator	22336944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP C	Xeroderma Pigmentosum	BEFREE	30555679		★★★★★ ★☆☆☆☆ Found in Text Mining only

MAPK14 (mitogen-activated protein kinase 14)