Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	8480
Gene name	Ribonucleic acid export 1
Gene symbol	RAE1
Synonyms (NCBI Gene)	Gle2MIG14MRNP41Mnrp41dJ481F12.3dJ800J21.1
Chromosome	20
Chromosome location	20q13.31
Summary	Mutations in the Schizosaccharomyces pombe Rae1 and Saccharomyces cerevisiae Gle2 genes have been shown to result in accumulation of poly(A)-containing mRNA in the nucleus, suggesting that the encoded proteins are involved in RNA export. The protein encod

194 Show/Hide all (194)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025213	hsa-miR-34a-5p	Proteomics	21566225
MIRT025213	hsa-miR-34a-5p	Proteomics	21566225
MIRT029494	hsa-miR-26b-5p	Microarray	19088304
MIRT046487	hsa-miR-15b-5p	CLASH	23622248
MIRT045362	hsa-miR-185-5p	CLASH	23622248
MIRT044107	hsa-miR-361-5p	CLASH	23622248
MIRT1288331	hsa-miR-1283	CLIP-seq
MIRT1288332	hsa-miR-3150a-5p	CLIP-seq
MIRT1288333	hsa-miR-3150b-5p	CLIP-seq
MIRT1288334	hsa-miR-338-5p	CLIP-seq
MIRT1288335	hsa-miR-3618	CLIP-seq
MIRT1288336	hsa-miR-3649	CLIP-seq
MIRT1288337	hsa-miR-4505	CLIP-seq
MIRT1288338	hsa-miR-4640-3p	CLIP-seq
MIRT1288339	hsa-miR-4716-5p	CLIP-seq
MIRT1288340	hsa-miR-4797-5p	CLIP-seq
MIRT1288341	hsa-miR-549	CLIP-seq
MIRT1288342	hsa-miR-711	CLIP-seq
MIRT1288343	hsa-miR-2276	CLIP-seq
MIRT1288344	hsa-miR-3120-3p	CLIP-seq
MIRT1288345	hsa-miR-4283	CLIP-seq
MIRT1288346	hsa-miR-4508	CLIP-seq
MIRT1288347	hsa-miR-4772-3p	CLIP-seq
MIRT1288348	hsa-miR-520d-5p	CLIP-seq
MIRT1288349	hsa-miR-524-5p	CLIP-seq
MIRT1288350	hsa-miR-548u	CLIP-seq
MIRT1288351	hsa-miR-556-3p	CLIP-seq
MIRT2085378	hsa-miR-1207-3p	CLIP-seq
MIRT2085379	hsa-miR-185	CLIP-seq
MIRT2085380	hsa-miR-203	CLIP-seq
MIRT1288343	hsa-miR-2276	CLIP-seq
MIRT1288344	hsa-miR-3120-3p	CLIP-seq
MIRT2085381	hsa-miR-3648	CLIP-seq
MIRT2085382	hsa-miR-378g	CLIP-seq
MIRT2085383	hsa-miR-3913-3p	CLIP-seq
MIRT2085384	hsa-miR-3925-3p	CLIP-seq
MIRT1288345	hsa-miR-4283	CLIP-seq
MIRT2085385	hsa-miR-4292	CLIP-seq
MIRT2085386	hsa-miR-4306	CLIP-seq
MIRT2085387	hsa-miR-4308	CLIP-seq
MIRT2085388	hsa-miR-4437	CLIP-seq
MIRT1288346	hsa-miR-4508	CLIP-seq
MIRT2085389	hsa-miR-4644	CLIP-seq
MIRT2085390	hsa-miR-4668-3p	CLIP-seq
MIRT2085391	hsa-miR-4674	CLIP-seq
MIRT2085392	hsa-miR-4685-5p	CLIP-seq
MIRT2085393	hsa-miR-4707-3p	CLIP-seq
MIRT2085394	hsa-miR-4746-3p	CLIP-seq
MIRT1288347	hsa-miR-4772-3p	CLIP-seq
MIRT2085395	hsa-miR-489	CLIP-seq
MIRT2085396	hsa-miR-515-5p	CLIP-seq
MIRT2085397	hsa-miR-518e	CLIP-seq
MIRT1288348	hsa-miR-520d-5p	CLIP-seq
MIRT1288349	hsa-miR-524-5p	CLIP-seq
MIRT2085398	hsa-miR-548al	CLIP-seq
MIRT1288350	hsa-miR-548u	CLIP-seq
MIRT1288351	hsa-miR-556-3p	CLIP-seq
MIRT2085399	hsa-miR-605	CLIP-seq
MIRT2085400	hsa-miR-661	CLIP-seq
MIRT2085401	hsa-miR-766	CLIP-seq
MIRT1288331	hsa-miR-1283	CLIP-seq
MIRT1288335	hsa-miR-3618	CLIP-seq
MIRT2085383	hsa-miR-3913-3p	CLIP-seq
MIRT2085385	hsa-miR-4292	CLIP-seq
MIRT2085387	hsa-miR-4308	CLIP-seq
MIRT2085390	hsa-miR-4668-3p	CLIP-seq
MIRT2310791	hsa-miR-4684-5p	CLIP-seq
MIRT2085393	hsa-miR-4707-3p	CLIP-seq
MIRT2085394	hsa-miR-4746-3p	CLIP-seq
MIRT2085395	hsa-miR-489	CLIP-seq
MIRT2085397	hsa-miR-518e	CLIP-seq
MIRT2085399	hsa-miR-605	CLIP-seq
MIRT2085382	hsa-miR-378g	CLIP-seq
MIRT2085400	hsa-miR-661	CLIP-seq
MIRT2607189	hsa-miR-1	CLIP-seq
MIRT1288331	hsa-miR-1283	CLIP-seq
MIRT2607190	hsa-miR-143	CLIP-seq
MIRT2607191	hsa-miR-149	CLIP-seq
MIRT2607192	hsa-miR-1827	CLIP-seq
MIRT2085379	hsa-miR-185	CLIP-seq
MIRT2085380	hsa-miR-203	CLIP-seq
MIRT2607193	hsa-miR-206	CLIP-seq
MIRT1288343	hsa-miR-2276	CLIP-seq
MIRT2607194	hsa-miR-2682	CLIP-seq
MIRT2607195	hsa-miR-3064-5p	CLIP-seq
MIRT1288332	hsa-miR-3150a-5p	CLIP-seq
MIRT1288333	hsa-miR-3150b-5p	CLIP-seq
MIRT1288334	hsa-miR-338-5p	CLIP-seq
MIRT2607196	hsa-miR-34a	CLIP-seq
MIRT2607197	hsa-miR-34c-5p	CLIP-seq
MIRT1288335	hsa-miR-3618	CLIP-seq
MIRT2085381	hsa-miR-3648	CLIP-seq
MIRT1288336	hsa-miR-3649	CLIP-seq
MIRT2607198	hsa-miR-3673	CLIP-seq
MIRT2085382	hsa-miR-378g	CLIP-seq
MIRT2085383	hsa-miR-3913-3p	CLIP-seq
MIRT2085384	hsa-miR-3925-3p	CLIP-seq
MIRT2085385	hsa-miR-4292	CLIP-seq
MIRT2085386	hsa-miR-4306	CLIP-seq
MIRT2085387	hsa-miR-4308	CLIP-seq
MIRT2085388	hsa-miR-4437	CLIP-seq
MIRT2607199	hsa-miR-449a	CLIP-seq
MIRT2607200	hsa-miR-449b	CLIP-seq
MIRT2607201	hsa-miR-449c	CLIP-seq
MIRT1288337	hsa-miR-4505	CLIP-seq
MIRT2607202	hsa-miR-4514	CLIP-seq
MIRT1288338	hsa-miR-4640-3p	CLIP-seq
MIRT2085389	hsa-miR-4644	CLIP-seq
MIRT2607203	hsa-miR-4663	CLIP-seq
MIRT2085390	hsa-miR-4668-3p	CLIP-seq
MIRT2085391	hsa-miR-4674	CLIP-seq
MIRT2085392	hsa-miR-4685-5p	CLIP-seq
MIRT2607204	hsa-miR-4692	CLIP-seq
MIRT2085393	hsa-miR-4707-3p	CLIP-seq
MIRT1288339	hsa-miR-4716-5p	CLIP-seq
MIRT2085394	hsa-miR-4746-3p	CLIP-seq
MIRT2607205	hsa-miR-4756-3p	CLIP-seq
MIRT2607206	hsa-miR-4770	CLIP-seq
MIRT1288347	hsa-miR-4772-3p	CLIP-seq
MIRT2607207	hsa-miR-4794	CLIP-seq
MIRT1288340	hsa-miR-4797-5p	CLIP-seq
MIRT2085395	hsa-miR-489	CLIP-seq
MIRT2085396	hsa-miR-515-5p	CLIP-seq
MIRT2085397	hsa-miR-518e	CLIP-seq
MIRT2607208	hsa-miR-548ae	CLIP-seq
MIRT2607209	hsa-miR-548aj	CLIP-seq
MIRT2085398	hsa-miR-548al	CLIP-seq
MIRT2607210	hsa-miR-548am	CLIP-seq
MIRT2607211	hsa-miR-548x	CLIP-seq
MIRT1288341	hsa-miR-549	CLIP-seq
MIRT2085399	hsa-miR-605	CLIP-seq
MIRT2607212	hsa-miR-613	CLIP-seq
MIRT2085400	hsa-miR-661	CLIP-seq
MIRT1288342	hsa-miR-711	CLIP-seq
MIRT2607213	hsa-miR-759	CLIP-seq
MIRT2085401	hsa-miR-766	CLIP-seq
MIRT2607189	hsa-miR-1	CLIP-seq
MIRT1288331	hsa-miR-1283	CLIP-seq
MIRT2607190	hsa-miR-143	CLIP-seq
MIRT2607191	hsa-miR-149	CLIP-seq
MIRT2607192	hsa-miR-1827	CLIP-seq
MIRT2085379	hsa-miR-185	CLIP-seq
MIRT2085380	hsa-miR-203	CLIP-seq
MIRT2607193	hsa-miR-206	CLIP-seq
MIRT1288343	hsa-miR-2276	CLIP-seq
MIRT2607194	hsa-miR-2682	CLIP-seq
MIRT2607195	hsa-miR-3064-5p	CLIP-seq
MIRT1288332	hsa-miR-3150a-5p	CLIP-seq
MIRT1288333	hsa-miR-3150b-5p	CLIP-seq
MIRT1288334	hsa-miR-338-5p	CLIP-seq
MIRT2607196	hsa-miR-34a	CLIP-seq
MIRT2607197	hsa-miR-34c-5p	CLIP-seq
MIRT1288335	hsa-miR-3618	CLIP-seq
MIRT2085381	hsa-miR-3648	CLIP-seq
MIRT1288336	hsa-miR-3649	CLIP-seq
MIRT2607198	hsa-miR-3673	CLIP-seq
MIRT2085383	hsa-miR-3913-3p	CLIP-seq
MIRT2085384	hsa-miR-3925-3p	CLIP-seq
MIRT2085385	hsa-miR-4292	CLIP-seq
MIRT2085386	hsa-miR-4306	CLIP-seq
MIRT2085387	hsa-miR-4308	CLIP-seq
MIRT2607199	hsa-miR-449a	CLIP-seq
MIRT2607200	hsa-miR-449b	CLIP-seq
MIRT2607201	hsa-miR-449c	CLIP-seq
MIRT1288337	hsa-miR-4505	CLIP-seq
MIRT2607202	hsa-miR-4514	CLIP-seq
MIRT1288338	hsa-miR-4640-3p	CLIP-seq
MIRT2085389	hsa-miR-4644	CLIP-seq
MIRT2607203	hsa-miR-4663	CLIP-seq
MIRT2085390	hsa-miR-4668-3p	CLIP-seq
MIRT2085392	hsa-miR-4685-5p	CLIP-seq
MIRT2607204	hsa-miR-4692	CLIP-seq
MIRT2085393	hsa-miR-4707-3p	CLIP-seq
MIRT1288339	hsa-miR-4716-5p	CLIP-seq
MIRT2085394	hsa-miR-4746-3p	CLIP-seq
MIRT2607205	hsa-miR-4756-3p	CLIP-seq
MIRT2607206	hsa-miR-4770	CLIP-seq
MIRT1288347	hsa-miR-4772-3p	CLIP-seq
MIRT2607207	hsa-miR-4794	CLIP-seq
MIRT1288340	hsa-miR-4797-5p	CLIP-seq
MIRT2085395	hsa-miR-489	CLIP-seq
MIRT2085396	hsa-miR-515-5p	CLIP-seq
MIRT2085397	hsa-miR-518e	CLIP-seq
MIRT2607208	hsa-miR-548ae	CLIP-seq
MIRT2607209	hsa-miR-548aj	CLIP-seq
MIRT2085398	hsa-miR-548al	CLIP-seq
MIRT2607210	hsa-miR-548am	CLIP-seq
MIRT2607211	hsa-miR-548x	CLIP-seq
MIRT1288341	hsa-miR-549	CLIP-seq
MIRT2085399	hsa-miR-605	CLIP-seq
MIRT2607212	hsa-miR-613	CLIP-seq
MIRT1288342	hsa-miR-711	CLIP-seq
MIRT2607213	hsa-miR-759	CLIP-seq
MIRT2085401	hsa-miR-766	CLIP-seq

27 Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000922	Component	Spindle pole	IEA
GO:0000972	Process	Transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery	IBA
GO:0001650	Component	Fibrillar center	IDA
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IDA	9256445
GO:0005515	Function	Protein binding	IPI	17172455, 18832153, 20498086, 25544563, 25959826, 29293652, 32353859, 32814053, 32838362, 33060197, 33097660, 33765414, 33849972, 33961781, 35096974, 35271311, 36217030
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9370289
GO:0005635	Component	Nuclear envelope	IDA	9256445, 24315095
GO:0005635	Component	Nuclear envelope	IEA
GO:0005635	Component	Nuclear envelope	TAS
GO:0005643	Component	Nuclear pore	IBA
GO:0005643	Component	Nuclear pore	IDA	9256445
GO:0005643	Component	Nuclear pore	NAS	24315095
GO:0005643	Component	Nuclear pore	TAS	10209021
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	10209021
GO:0005856	Component	Cytoskeleton	IEA
GO:0006405	Process	RNA export from nucleus	IBA
GO:0006406	Process	MRNA export from nucleus	TAS	10209021
GO:0006913	Process	Nucleocytoplasmic transport	NAS	27016207
GO:0008017	Function	Microtubule binding	ISS	15851029
GO:0043130	Function	Ubiquitin binding	IBA
GO:0051301	Process	Cell division	IEA
GO:0060236	Process	Regulation of mitotic spindle organization	IMP	17172455
GO:0097431	Component	Mitotic spindle pole	IMP	17172455

MIM	HGNC	e!Ensembl
603343	9828	ENSG00000101146

P78406

Protein name

mRNA export factor RAE1 (Rae1 protein homolog) (mRNA-associated protein mrnp 41)

Protein function

Acts as a mRNA export factor involved in nucleocytoplasmic transport (PubMed:20498086, PubMed:33849972). Plays a role in mitotic bipolar spindle formation (PubMed:17172455). May function in attaching cytoplasmic mRNPs to the cytoskeleton both di

PDB

3MMY , 4OWR , 7F60 , 7F90 , 7VPG , 7VPH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00400	WD40	79 → 114	WD domain, G-beta repeat	Repeat
PF00400	WD40	119 → 157	WD domain, G-beta repeat	Repeat

Sequence

MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAG
SWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQA
IQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIY
PMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRV
AIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFW
DKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAE
ELKPRNKK

Sequence length

368

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Nucleocytoplasmic transport	ISG15 antiviral mechanism
Amyotrophic lateral sclerosis	Transport of the SLBP independent Mature mRNA
Influenza A	Transport of the SLBP Dependant Mature mRNA
	Transport of Mature mRNA Derived from an Intronless Transcript
	Transport of Mature mRNA derived from an Intron-Containing Transcript
	Rev-mediated nuclear export of HIV RNA
	Transport of Ribonucleoproteins into the Host Nucleus
	NS1 Mediated Effects on Host Pathways
	Viral Messenger RNA Synthesis
	NEP/NS2 Interacts with the Cellular Export Machinery
	Regulation of Glucokinase by Glucokinase Regulatory Protein
	Vpr-mediated nuclear import of PICs
	snRNP Assembly
	SUMOylation of DNA damage response and repair proteins
	SUMOylation of ubiquitinylation proteins
	Nuclear Pore Complex (NPC) Disassembly
	Regulation of HSF1-mediated heat shock response
	SUMOylation of SUMOylation proteins
	SUMOylation of chromatin organization proteins
	SUMOylation of RNA binding proteins
	SUMOylation of DNA replication proteins
	Transcriptional regulation by small RNAs
	Defective TPR may confer susceptibility towards thyroid papillary carcinoma (TPC)
	tRNA processing in the nucleus
	HCMV Early Events
	HCMV Late Events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
GESTATIONAL DIABETES	—	GWAS catalog	37779084	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
NUP50	[]	27	["Nucleocytoplasmic transport","Regulation of HSF1-mediated heat shock response","HCMV Late Events","SUMOylation of DNA damage response and repair proteins","SUMOylation of chromatin organization proteins","SUMOylation of RNA binding proteins","snRNP Assembly","HCMV Early Events","Transport of the SLBP independent Mature mRNA","Transport of the SLBP Dependant Mature mRNA","Transport of Mature mRNA Derived from an Intronless Transcript","Transport of Mature mRNA derived from an Intron-Containing Transcript"]	[]
NUP42	[]	27	["Nucleocytoplasmic transport","Regulation of HSF1-mediated heat shock response","HCMV Late Events","SUMOylation of DNA damage response and repair proteins","SUMOylation of chromatin organization proteins","SUMOylation of RNA binding proteins","snRNP Assembly","HCMV Early Events","Transport of the SLBP independent Mature mRNA","Transport of the SLBP Dependant Mature mRNA","Transport of Mature mRNA Derived from an Intronless Transcript","Transport of Mature mRNA derived from an Intron-Containing Transcript"]	[]
NUP210	[]	27	["Nucleocytoplasmic transport","Regulation of HSF1-mediated heat shock response","HCMV Late Events","SUMOylation of DNA damage response and repair proteins","SUMOylation of chromatin organization proteins","SUMOylation of RNA binding proteins","snRNP Assembly","HCMV Early Events","Transport of the SLBP independent Mature mRNA","Transport of the SLBP Dependant Mature mRNA","Transport of Mature mRNA Derived from an Intronless Transcript","Transport of Mature mRNA derived from an Intron-Containing Transcript"]	[]
NUP62	[]	27	["Nucleocytoplasmic transport","Regulation of HSF1-mediated heat shock response","HCMV Late Events","SUMOylation of DNA damage response and repair proteins","SUMOylation of chromatin organization proteins","SUMOylation of RNA binding proteins","snRNP Assembly","HCMV Early Events","Transport of the SLBP independent Mature mRNA","Transport of the SLBP Dependant Mature mRNA","Transport of Mature mRNA Derived from an Intronless Transcript","Transport of Mature mRNA derived from an Intron-Containing Transcript"]	[]
NUP88	[]	27	["Nucleocytoplasmic transport","Regulation of HSF1-mediated heat shock response","HCMV Late Events","SUMOylation of DNA damage response and repair proteins","SUMOylation of chromatin organization proteins","SUMOylation of RNA binding proteins","snRNP Assembly","HCMV Early Events","Transport of the SLBP independent Mature mRNA","Transport of the SLBP Dependant Mature mRNA","Transport of Mature mRNA Derived from an Intronless Transcript","Transport of Mature mRNA derived from an Intron-Containing Transcript"]	[]

RAE1 (ribonucleic acid export 1)

Save This Analysis