Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	23225
Gene name	Nucleoporin 210
Gene symbol	NUP210
Synonyms (NCBI Gene)	GP210POM210
Chromosome	3
Chromosome location	3p25.1
Summary	The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex i

398 Show/Hide all (398)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018659	hsa-miR-335-5p	Microarray	18185580
MIRT023939	hsa-miR-1-3p	Proteomics	18668040
MIRT049762	hsa-miR-92a-3p	CLASH	23622248
MIRT046916	hsa-miR-221-3p	CLASH	23622248
MIRT046399	hsa-miR-15b-5p	CLASH	23622248
MIRT042645	hsa-miR-423-3p	CLASH	23622248
MIRT040810	hsa-miR-18a-3p	CLASH	23622248
MIRT038351	hsa-miR-296-3p	CLASH	23622248
MIRT036333	hsa-miR-1229-3p	CLASH	23622248
MIRT701289	hsa-miR-193a-5p	HITS-CLIP	23313552
MIRT701288	hsa-miR-8080	HITS-CLIP	23313552
MIRT701287	hsa-miR-6757-3p	HITS-CLIP	23313552
MIRT701286	hsa-miR-1197	HITS-CLIP	23313552
MIRT701285	hsa-miR-6808-5p	HITS-CLIP	23313552
MIRT701284	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT701283	hsa-miR-940	HITS-CLIP	23313552
MIRT701282	hsa-miR-6830-5p	HITS-CLIP	23313552
MIRT701281	hsa-miR-4436a	HITS-CLIP	23313552
MIRT701280	hsa-miR-5000-3p	HITS-CLIP	23313552
MIRT701279	hsa-miR-370-3p	HITS-CLIP	23313552
MIRT701278	hsa-miR-6893-3p	HITS-CLIP	23313552
MIRT701277	hsa-miR-1976	HITS-CLIP	23313552
MIRT701276	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT701275	hsa-miR-4769-3p	HITS-CLIP	23313552
MIRT701274	hsa-miR-6817-5p	HITS-CLIP	23313552
MIRT701273	hsa-miR-3117-5p	HITS-CLIP	23313552
MIRT701272	hsa-miR-1827	HITS-CLIP	23313552
MIRT701271	hsa-miR-1286	HITS-CLIP	23313552
MIRT701270	hsa-miR-4663	HITS-CLIP	23313552
MIRT701269	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT701268	hsa-miR-8077	HITS-CLIP	23313552
MIRT701267	hsa-miR-6882-3p	HITS-CLIP	23313552
MIRT701266	hsa-miR-561-5p	HITS-CLIP	23313552
MIRT701265	hsa-miR-513c-5p	HITS-CLIP	23313552
MIRT701264	hsa-miR-514b-5p	HITS-CLIP	23313552
MIRT701263	hsa-miR-6844	HITS-CLIP	23313552
MIRT701262	hsa-miR-218-5p	HITS-CLIP	23313552
MIRT701261	hsa-miR-2113	HITS-CLIP	23313552
MIRT701289	hsa-miR-193a-5p	HITS-CLIP	23313552
MIRT701288	hsa-miR-8080	HITS-CLIP	23313552
MIRT701287	hsa-miR-6757-3p	HITS-CLIP	23313552
MIRT701286	hsa-miR-1197	HITS-CLIP	23313552
MIRT701285	hsa-miR-6808-5p	HITS-CLIP	23313552
MIRT701284	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT701283	hsa-miR-940	HITS-CLIP	23313552
MIRT701282	hsa-miR-6830-5p	HITS-CLIP	23313552
MIRT701281	hsa-miR-4436a	HITS-CLIP	23313552
MIRT701280	hsa-miR-5000-3p	HITS-CLIP	23313552
MIRT701279	hsa-miR-370-3p	HITS-CLIP	23313552
MIRT701278	hsa-miR-6893-3p	HITS-CLIP	23313552
MIRT701277	hsa-miR-1976	HITS-CLIP	23313552
MIRT701276	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT701275	hsa-miR-4769-3p	HITS-CLIP	23313552
MIRT701274	hsa-miR-6817-5p	HITS-CLIP	23313552
MIRT701273	hsa-miR-3117-5p	HITS-CLIP	23313552
MIRT701272	hsa-miR-1827	HITS-CLIP	23313552
MIRT701271	hsa-miR-1286	HITS-CLIP	23313552
MIRT701270	hsa-miR-4663	HITS-CLIP	23313552
MIRT701269	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT701268	hsa-miR-8077	HITS-CLIP	23313552
MIRT701267	hsa-miR-6882-3p	HITS-CLIP	23313552
MIRT701266	hsa-miR-561-5p	HITS-CLIP	23313552
MIRT701265	hsa-miR-513c-5p	HITS-CLIP	23313552
MIRT701264	hsa-miR-514b-5p	HITS-CLIP	23313552
MIRT701263	hsa-miR-6844	HITS-CLIP	23313552
MIRT701262	hsa-miR-218-5p	HITS-CLIP	23313552
MIRT701261	hsa-miR-2113	HITS-CLIP	23313552
MIRT1199152	hsa-miR-101	CLIP-seq
MIRT1199153	hsa-miR-1207-5p	CLIP-seq
MIRT1199154	hsa-miR-122	CLIP-seq
MIRT1199155	hsa-miR-1234	CLIP-seq
MIRT1199156	hsa-miR-124	CLIP-seq
MIRT1199157	hsa-miR-1247	CLIP-seq
MIRT1199158	hsa-miR-1253	CLIP-seq
MIRT1199159	hsa-miR-1254	CLIP-seq
MIRT1199160	hsa-miR-125a-5p	CLIP-seq
MIRT1199161	hsa-miR-125b	CLIP-seq
MIRT1199162	hsa-miR-1264	CLIP-seq
MIRT1199163	hsa-miR-1276	CLIP-seq
MIRT1199164	hsa-miR-1297	CLIP-seq
MIRT1199165	hsa-miR-139-5p	CLIP-seq
MIRT1199166	hsa-miR-144	CLIP-seq
MIRT1199167	hsa-miR-147b	CLIP-seq
MIRT1199168	hsa-miR-15a	CLIP-seq
MIRT1199169	hsa-miR-15b	CLIP-seq
MIRT1199170	hsa-miR-16	CLIP-seq
MIRT1199171	hsa-miR-195	CLIP-seq
MIRT1199172	hsa-miR-210	CLIP-seq
MIRT1199173	hsa-miR-218	CLIP-seq
MIRT1199174	hsa-miR-22	CLIP-seq
MIRT1199175	hsa-miR-223	CLIP-seq
MIRT1199176	hsa-miR-24	CLIP-seq
MIRT1199177	hsa-miR-26a	CLIP-seq
MIRT1199178	hsa-miR-26b	CLIP-seq
MIRT1199179	hsa-miR-27a	CLIP-seq
MIRT1199180	hsa-miR-27b	CLIP-seq
MIRT1199181	hsa-miR-2861	CLIP-seq
MIRT1199182	hsa-miR-3116	CLIP-seq
MIRT1199183	hsa-miR-3148	CLIP-seq
MIRT1199184	hsa-miR-3153	CLIP-seq
MIRT1199185	hsa-miR-3154	CLIP-seq
MIRT1199186	hsa-miR-3160-3p	CLIP-seq
MIRT1199187	hsa-miR-3179	CLIP-seq
MIRT1199188	hsa-miR-323b-5p	CLIP-seq
MIRT1199189	hsa-miR-326	CLIP-seq
MIRT1199190	hsa-miR-330-5p	CLIP-seq
MIRT1199191	hsa-miR-342-3p	CLIP-seq
MIRT1199192	hsa-miR-3677-5p	CLIP-seq
MIRT1199193	hsa-miR-3690	CLIP-seq
MIRT1199194	hsa-miR-376c	CLIP-seq
MIRT1199195	hsa-miR-378	CLIP-seq
MIRT1199196	hsa-miR-378b	CLIP-seq
MIRT1199197	hsa-miR-378c	CLIP-seq
MIRT1199198	hsa-miR-378d	CLIP-seq
MIRT1199199	hsa-miR-378e	CLIP-seq
MIRT1199200	hsa-miR-378f	CLIP-seq
MIRT1199201	hsa-miR-378h	CLIP-seq
MIRT1199202	hsa-miR-378i	CLIP-seq
MIRT1199203	hsa-miR-3925-3p	CLIP-seq
MIRT1199204	hsa-miR-3937	CLIP-seq
MIRT1199205	hsa-miR-3973	CLIP-seq
MIRT1199206	hsa-miR-422a	CLIP-seq
MIRT1199207	hsa-miR-424	CLIP-seq
MIRT1199208	hsa-miR-425	CLIP-seq
MIRT1199209	hsa-miR-4254	CLIP-seq
MIRT1199210	hsa-miR-4267	CLIP-seq
MIRT1199211	hsa-miR-4268	CLIP-seq
MIRT1199212	hsa-miR-4284	CLIP-seq
MIRT1199213	hsa-miR-4287	CLIP-seq
MIRT1199214	hsa-miR-4300	CLIP-seq
MIRT1199215	hsa-miR-4311	CLIP-seq
MIRT1199216	hsa-miR-4319	CLIP-seq
MIRT1199217	hsa-miR-4324	CLIP-seq
MIRT1199218	hsa-miR-4328	CLIP-seq
MIRT1199219	hsa-miR-4329	CLIP-seq
MIRT1199220	hsa-miR-4330	CLIP-seq
MIRT1199221	hsa-miR-4446-5p	CLIP-seq
MIRT1199222	hsa-miR-4448	CLIP-seq
MIRT1199223	hsa-miR-4459	CLIP-seq
MIRT1199224	hsa-miR-4465	CLIP-seq
MIRT1199225	hsa-miR-4469	CLIP-seq
MIRT1199226	hsa-miR-4477a	CLIP-seq
MIRT1199227	hsa-miR-4487	CLIP-seq
MIRT1199228	hsa-miR-4496	CLIP-seq
MIRT1199229	hsa-miR-4502	CLIP-seq
MIRT1199230	hsa-miR-4503	CLIP-seq
MIRT1199231	hsa-miR-4509	CLIP-seq
MIRT1199232	hsa-miR-4517	CLIP-seq
MIRT1199233	hsa-miR-451b	CLIP-seq
MIRT1199234	hsa-miR-4524	CLIP-seq
MIRT1199235	hsa-miR-4659a-5p	CLIP-seq
MIRT1199236	hsa-miR-4659b-5p	CLIP-seq
MIRT1199237	hsa-miR-4668-5p	CLIP-seq
MIRT1199238	hsa-miR-4679	CLIP-seq
MIRT1199239	hsa-miR-4685-3p	CLIP-seq
MIRT1199240	hsa-miR-4686	CLIP-seq
MIRT1199241	hsa-miR-4688	CLIP-seq
MIRT1199242	hsa-miR-4697-3p	CLIP-seq
MIRT1199243	hsa-miR-4699-3p	CLIP-seq
MIRT1199244	hsa-miR-4708-3p	CLIP-seq
MIRT1199245	hsa-miR-4713-3p	CLIP-seq
MIRT1199246	hsa-miR-4716-3p	CLIP-seq
MIRT1199247	hsa-miR-4732-3p	CLIP-seq
MIRT1199248	hsa-miR-4736	CLIP-seq
MIRT1199249	hsa-miR-4744	CLIP-seq
MIRT1199250	hsa-miR-4755-5p	CLIP-seq
MIRT1199251	hsa-miR-4763-3p	CLIP-seq
MIRT1199252	hsa-miR-4766-3p	CLIP-seq
MIRT1199253	hsa-miR-4782-5p	CLIP-seq
MIRT1199254	hsa-miR-4786-5p	CLIP-seq
MIRT1199255	hsa-miR-4793-5p	CLIP-seq
MIRT1199256	hsa-miR-4796-3p	CLIP-seq
MIRT1199257	hsa-miR-4799-5p	CLIP-seq
MIRT1199258	hsa-miR-497	CLIP-seq
MIRT1199259	hsa-miR-500a	CLIP-seq
MIRT1199260	hsa-miR-501-5p	CLIP-seq
MIRT1199261	hsa-miR-503	CLIP-seq
MIRT1199262	hsa-miR-506	CLIP-seq
MIRT1199263	hsa-miR-5096	CLIP-seq
MIRT1199264	hsa-miR-513a-5p	CLIP-seq
MIRT1199265	hsa-miR-515-5p	CLIP-seq
MIRT1199266	hsa-miR-516b	CLIP-seq
MIRT1199267	hsa-miR-520g	CLIP-seq
MIRT1199268	hsa-miR-520h	CLIP-seq
MIRT1199269	hsa-miR-526b	CLIP-seq
MIRT1199270	hsa-miR-544b	CLIP-seq
MIRT1199271	hsa-miR-548a-5p	CLIP-seq
MIRT1199272	hsa-miR-548ab	CLIP-seq
MIRT1199273	hsa-miR-548ac	CLIP-seq
MIRT1199274	hsa-miR-548ak	CLIP-seq
MIRT1199275	hsa-miR-548b-5p	CLIP-seq
MIRT1199276	hsa-miR-548c-3p	CLIP-seq
MIRT1199277	hsa-miR-548c-5p	CLIP-seq
MIRT1199278	hsa-miR-548d-3p	CLIP-seq
MIRT1199279	hsa-miR-548d-5p	CLIP-seq
MIRT1199280	hsa-miR-548h	CLIP-seq
MIRT1199281	hsa-miR-548i	CLIP-seq
MIRT1199282	hsa-miR-548j	CLIP-seq
MIRT1199283	hsa-miR-548w	CLIP-seq
MIRT1199284	hsa-miR-548y	CLIP-seq
MIRT1199285	hsa-miR-548z	CLIP-seq
MIRT1199286	hsa-miR-549	CLIP-seq
MIRT1199287	hsa-miR-556-5p	CLIP-seq
MIRT1199288	hsa-miR-558	CLIP-seq
MIRT1199289	hsa-miR-559	CLIP-seq
MIRT1199290	hsa-miR-580	CLIP-seq
MIRT1199291	hsa-miR-583	CLIP-seq
MIRT1199292	hsa-miR-625	CLIP-seq
MIRT1199293	hsa-miR-646	CLIP-seq
MIRT1199294	hsa-miR-670	CLIP-seq
MIRT1199295	hsa-miR-765	CLIP-seq
MIRT1199296	hsa-miR-766	CLIP-seq
MIRT1199297	hsa-miR-767-3p	CLIP-seq
MIRT1199298	hsa-miR-769-5p	CLIP-seq
MIRT1199299	hsa-miR-873	CLIP-seq
MIRT1199300	hsa-miR-920	CLIP-seq
MIRT1199301	hsa-miR-936	CLIP-seq
MIRT2057737	hsa-miR-103a	CLIP-seq
MIRT2057738	hsa-miR-107	CLIP-seq
MIRT2057739	hsa-miR-1257	CLIP-seq
MIRT1199160	hsa-miR-125a-5p	CLIP-seq
MIRT1199161	hsa-miR-125b	CLIP-seq
MIRT2057740	hsa-miR-1291	CLIP-seq
MIRT2057741	hsa-miR-145	CLIP-seq
MIRT2057742	hsa-miR-1825	CLIP-seq
MIRT2057743	hsa-miR-1915	CLIP-seq
MIRT2057744	hsa-miR-198	CLIP-seq
MIRT2057745	hsa-miR-199a-5p	CLIP-seq
MIRT2057746	hsa-miR-199b-5p	CLIP-seq
MIRT2057747	hsa-miR-204	CLIP-seq
MIRT2057748	hsa-miR-211	CLIP-seq
MIRT2057749	hsa-miR-214	CLIP-seq
MIRT1199173	hsa-miR-218	CLIP-seq
MIRT1199179	hsa-miR-27a	CLIP-seq
MIRT1199180	hsa-miR-27b	CLIP-seq
MIRT2057750	hsa-miR-3136-3p	CLIP-seq
MIRT2057751	hsa-miR-3158-3p	CLIP-seq
MIRT2057752	hsa-miR-3169	CLIP-seq
MIRT2057753	hsa-miR-3176	CLIP-seq
MIRT2057754	hsa-miR-3184	CLIP-seq
MIRT2057755	hsa-miR-34a	CLIP-seq
MIRT2057756	hsa-miR-34c-5p	CLIP-seq
MIRT2057757	hsa-miR-3619-5p	CLIP-seq
MIRT2057758	hsa-miR-3654	CLIP-seq
MIRT2057759	hsa-miR-370	CLIP-seq
MIRT2057760	hsa-miR-3922-3p	CLIP-seq
MIRT2057761	hsa-miR-423-5p	CLIP-seq
MIRT1199208	hsa-miR-425	CLIP-seq
MIRT2057762	hsa-miR-4292	CLIP-seq
MIRT2057763	hsa-miR-4302	CLIP-seq
MIRT2057764	hsa-miR-4305	CLIP-seq
MIRT1199216	hsa-miR-4319	CLIP-seq
MIRT1199217	hsa-miR-4324	CLIP-seq
MIRT1199219	hsa-miR-4329	CLIP-seq
MIRT1199220	hsa-miR-4330	CLIP-seq
MIRT1199221	hsa-miR-4446-5p	CLIP-seq
MIRT1199223	hsa-miR-4459	CLIP-seq
MIRT2057765	hsa-miR-449a	CLIP-seq
MIRT2057766	hsa-miR-449b	CLIP-seq
MIRT2057767	hsa-miR-4512	CLIP-seq
MIRT1199232	hsa-miR-4517	CLIP-seq
MIRT2057768	hsa-miR-4638-3p	CLIP-seq
MIRT2057769	hsa-miR-4685-5p	CLIP-seq
MIRT2057770	hsa-miR-4717-3p	CLIP-seq
MIRT1199247	hsa-miR-4732-3p	CLIP-seq
MIRT2057771	hsa-miR-4740-5p	CLIP-seq
MIRT1199250	hsa-miR-4755-5p	CLIP-seq
MIRT2057772	hsa-miR-4757-5p	CLIP-seq
MIRT2057773	hsa-miR-4780	CLIP-seq
MIRT1199254	hsa-miR-4786-5p	CLIP-seq
MIRT1199259	hsa-miR-500a	CLIP-seq
MIRT1199260	hsa-miR-501-5p	CLIP-seq
MIRT1199264	hsa-miR-513a-5p	CLIP-seq
MIRT2057774	hsa-miR-513c	CLIP-seq
MIRT1199266	hsa-miR-516b	CLIP-seq
MIRT2057775	hsa-miR-623	CLIP-seq
MIRT1199294	hsa-miR-670	CLIP-seq
MIRT2057776	hsa-miR-720	CLIP-seq
MIRT2057777	hsa-miR-761	CLIP-seq
MIRT2057778	hsa-miR-764	CLIP-seq
MIRT1199295	hsa-miR-765	CLIP-seq
MIRT1199296	hsa-miR-766	CLIP-seq
MIRT1199298	hsa-miR-769-5p	CLIP-seq
MIRT1199299	hsa-miR-873	CLIP-seq
MIRT2057737	hsa-miR-103a	CLIP-seq
MIRT2057738	hsa-miR-107	CLIP-seq
MIRT1199153	hsa-miR-1207-5p	CLIP-seq
MIRT1199154	hsa-miR-122	CLIP-seq
MIRT1199155	hsa-miR-1234	CLIP-seq
MIRT1199156	hsa-miR-124	CLIP-seq
MIRT2286101	hsa-miR-1245b-3p	CLIP-seq
MIRT1199159	hsa-miR-1254	CLIP-seq
MIRT2057739	hsa-miR-1257	CLIP-seq
MIRT1199160	hsa-miR-125a-5p	CLIP-seq
MIRT1199161	hsa-miR-125b	CLIP-seq
MIRT2286102	hsa-miR-1275	CLIP-seq
MIRT1199163	hsa-miR-1276	CLIP-seq
MIRT2286103	hsa-miR-128	CLIP-seq
MIRT2286104	hsa-miR-1296	CLIP-seq
MIRT1199164	hsa-miR-1297	CLIP-seq
MIRT2286105	hsa-miR-1299	CLIP-seq
MIRT2057741	hsa-miR-145	CLIP-seq
MIRT2057742	hsa-miR-1825	CLIP-seq
MIRT2057744	hsa-miR-198	CLIP-seq
MIRT2057745	hsa-miR-199a-5p	CLIP-seq
MIRT2057746	hsa-miR-199b-5p	CLIP-seq
MIRT2057749	hsa-miR-214	CLIP-seq
MIRT1199173	hsa-miR-218	CLIP-seq
MIRT1199175	hsa-miR-223	CLIP-seq
MIRT1199176	hsa-miR-24	CLIP-seq
MIRT2286106	hsa-miR-2467-5p	CLIP-seq
MIRT1199177	hsa-miR-26a	CLIP-seq
MIRT1199178	hsa-miR-26b	CLIP-seq
MIRT1199179	hsa-miR-27a	CLIP-seq
MIRT1199180	hsa-miR-27b	CLIP-seq
MIRT1199182	hsa-miR-3116	CLIP-seq
MIRT2057750	hsa-miR-3136-3p	CLIP-seq
MIRT2057752	hsa-miR-3169	CLIP-seq
MIRT2057754	hsa-miR-3184	CLIP-seq
MIRT1199188	hsa-miR-323b-5p	CLIP-seq
MIRT2286107	hsa-miR-337-5p	CLIP-seq
MIRT1199191	hsa-miR-342-3p	CLIP-seq
MIRT2286108	hsa-miR-342-5p	CLIP-seq
MIRT2057755	hsa-miR-34a	CLIP-seq
MIRT2057756	hsa-miR-34c-5p	CLIP-seq
MIRT2286109	hsa-miR-3611	CLIP-seq
MIRT2057757	hsa-miR-3619-5p	CLIP-seq
MIRT1199192	hsa-miR-3677-5p	CLIP-seq
MIRT1199193	hsa-miR-3690	CLIP-seq
MIRT1199195	hsa-miR-378	CLIP-seq
MIRT1199196	hsa-miR-378b	CLIP-seq
MIRT1199197	hsa-miR-378c	CLIP-seq
MIRT1199198	hsa-miR-378d	CLIP-seq
MIRT1199199	hsa-miR-378e	CLIP-seq
MIRT1199200	hsa-miR-378f	CLIP-seq
MIRT1199201	hsa-miR-378h	CLIP-seq
MIRT1199202	hsa-miR-378i	CLIP-seq
MIRT1199203	hsa-miR-3925-3p	CLIP-seq
MIRT1199204	hsa-miR-3937	CLIP-seq
MIRT1199206	hsa-miR-422a	CLIP-seq
MIRT2057761	hsa-miR-423-5p	CLIP-seq
MIRT1199208	hsa-miR-425	CLIP-seq
MIRT1199209	hsa-miR-4254	CLIP-seq
MIRT1199210	hsa-miR-4267	CLIP-seq
MIRT1199212	hsa-miR-4284	CLIP-seq
MIRT2057763	hsa-miR-4302	CLIP-seq
MIRT1199215	hsa-miR-4311	CLIP-seq
MIRT1199216	hsa-miR-4319	CLIP-seq
MIRT1199217	hsa-miR-4324	CLIP-seq
MIRT1199218	hsa-miR-4328	CLIP-seq
MIRT1199219	hsa-miR-4329	CLIP-seq
MIRT1199220	hsa-miR-4330	CLIP-seq
MIRT1199224	hsa-miR-4465	CLIP-seq
MIRT2057765	hsa-miR-449a	CLIP-seq
MIRT2057766	hsa-miR-449b	CLIP-seq
MIRT1199230	hsa-miR-4503	CLIP-seq
MIRT1199231	hsa-miR-4509	CLIP-seq
MIRT2057767	hsa-miR-4512	CLIP-seq
MIRT1199232	hsa-miR-4517	CLIP-seq
MIRT2286110	hsa-miR-4638-5p	CLIP-seq
MIRT2286111	hsa-miR-4641	CLIP-seq
MIRT2286112	hsa-miR-4664-5p	CLIP-seq
MIRT2286113	hsa-miR-4665-5p	CLIP-seq
MIRT1199240	hsa-miR-4686	CLIP-seq
MIRT1199242	hsa-miR-4697-3p	CLIP-seq
MIRT1199243	hsa-miR-4699-3p	CLIP-seq
MIRT1199244	hsa-miR-4708-3p	CLIP-seq
MIRT2286114	hsa-miR-4709-3p	CLIP-seq
MIRT1199247	hsa-miR-4732-3p	CLIP-seq
MIRT1199248	hsa-miR-4736	CLIP-seq
MIRT2057771	hsa-miR-4740-5p	CLIP-seq
MIRT1199249	hsa-miR-4744	CLIP-seq
MIRT1199250	hsa-miR-4755-5p	CLIP-seq
MIRT1199251	hsa-miR-4763-3p	CLIP-seq
MIRT1199253	hsa-miR-4782-5p	CLIP-seq
MIRT1199254	hsa-miR-4786-5p	CLIP-seq
MIRT1199255	hsa-miR-4793-5p	CLIP-seq
MIRT1199257	hsa-miR-4799-5p	CLIP-seq
MIRT2286115	hsa-miR-490-5p	CLIP-seq
MIRT2286116	hsa-miR-494	CLIP-seq
MIRT2286117	hsa-miR-499-3p	CLIP-seq
MIRT2286118	hsa-miR-499a-3p	CLIP-seq
MIRT1199262	hsa-miR-506	CLIP-seq
MIRT1199264	hsa-miR-513a-5p	CLIP-seq
MIRT1199265	hsa-miR-515-5p	CLIP-seq
MIRT1199266	hsa-miR-516b	CLIP-seq
MIRT1199270	hsa-miR-544b	CLIP-seq
MIRT1199276	hsa-miR-548c-3p	CLIP-seq
MIRT1199286	hsa-miR-549	CLIP-seq
MIRT1199291	hsa-miR-583	CLIP-seq
MIRT2286119	hsa-miR-635	CLIP-seq
MIRT2286120	hsa-miR-663b	CLIP-seq
MIRT1199294	hsa-miR-670	CLIP-seq
MIRT2057777	hsa-miR-761	CLIP-seq
MIRT1199296	hsa-miR-766	CLIP-seq
MIRT1199298	hsa-miR-769-5p	CLIP-seq
MIRT1199301	hsa-miR-936	CLIP-seq
MIRT2286121	hsa-miR-95	CLIP-seq

16 Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	28514442, 29961565, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IDA	24315095
GO:0005635	Component	Nuclear envelope	IEA
GO:0005635	Component	Nuclear envelope	TAS
GO:0005643	Component	Nuclear pore	IBA
GO:0005643	Component	Nuclear pore	IEA
GO:0005643	Component	Nuclear pore	NAS	24315095
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006913	Process	Nucleocytoplasmic transport	NAS	27016207
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0031965	Component	Nuclear membrane	IEA
GO:0051028	Process	MRNA transport	IEA

MIM	HGNC	e!Ensembl
607703	30052	ENSG00000132182

Q8TEM1

Protein name

Nuclear pore membrane glycoprotein 210 (Nuclear pore protein gp210) (Nuclear envelope pore membrane protein POM 210) (POM210) (Nucleoporin Nup210) (Pore membrane protein of 210 kDa)

Protein function

Nucleoporin essential for nuclear pore assembly and fusion, nuclear pore spacing, as well as structural integrity.

PDB

7R5J , 7R5K

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02368	Big_2	1077 → 1153	Bacterial Ig-like domain (group 2)	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous expression, with highest levels in lung, liver, pancreas, testis, and ovary, intermediate levels in brain, kidney, and spleen, and lowest levels in heart and skeletal muscle. {ECO:0000269|PubMed:10048485}.

Sequence

MAARGRGLLLLTLSVLLAAGPSAAAAKLNIPKVLLPFTRATRVNFTLEASEGCYRWLSTR
PEVASIEPLGLDEQQCSQKAVVQARLTQPARLTSIIFAEDITTGQVLRCDAIVDLIHDIQ
IVSTTRELYLEDSPLELKIQALDSEGNTFSTLAGLVFEWTIVKDSEADRFSDSHNALRIL
TFLESTYIPPSYISEMEKAAKQGDTILVSGMKTGSSKLKARIQEAVYKNVRPAEVRLLIL
ENILLNPAYDVYLMVGTSIHYKVQKIRQGKITELSMPSDQYELQLQNSIPGPEGDPARPV
AVLAQDTSMVTALQLGQSSLVLGHRSIRMQGASRLPNSTIYVVEPGYLGFTVHPGDRWVL
ETGRLYEITIEVFDKFSNKVYVSDNIRIETVLPAEFFEVLSSSQNGSYHRIRALKRGQTA
IDAALTSVVDQDGGVHILQVPVWNQQEVEIHIPITLYPSILTFPWQPKTGAYQYTIRAHG
GSGNFSWSSSSHLVATVTVKGVMTTGSDIGFSVIQAHDVQNPLHFGEMKVYVIEPHSMEF
APCQVEARVGQALELPLRISGLMPGGASEVVTLSDCSHFDLAVEVENQGVFQPLPGRLPP
GSEHCSGIRVKAEAQGSTTLLVSYRHGHVHLSAKITIAAYLPLKAVDPSSVALVTLGSSK
EMLFEGGPRPWILEPSKFFQNVTAEDTDSIGLALFAPHSSRNYQQHWILVTCQALGEQVI
ALSVGNKPSLTNPFPAVEPAVVKFVCAPPSRLTLAPVYTSPQLDMSCPLLQQNKQVVPVS
SHRNPRLDLAAYDQEGRRFDNFSSLSIQWESTRPVLASIEPELPMQLVSQDDESGQKKLH
GLQAILVHEASGTTAITATATGYQESHLSSARTKQPHDPLVPLSASIELILVEDVRVSPE
EVTIYNHPGIQAELRIREGSGYFFLNTSTADVVKVAYQEARGVAMVHPLLPGSSTIMIHD
LCLVFPAPAKAVVYVSDIQELYIRVVDKVEIGKTVKAYVRVLDLHKKPFLAKYFPFMDLK
LRAASPIITLVALDEALDNYTITFLIRGVAIGQTSLTASVTNKAGQRINSAPQQIEVFPP
FRLMPRKVTLLIGATMQVTSEGGPQPQSNILFSISNESVALVSAAGLVQGLAIGNGTVSG
LVQAVDAETGKVVIISQDLVQVEVLLLRAVRIRAPIMRMRTGTQMPIYVTGITNHQNPFS
FGNAVPGLTFHWSVTKRDVLDLRGRHHEASIRLPSQYNFAMNVLGRVKGRTGLRVVVKAV
DPTSGQLYGLARELSDEIQVQVFEKLQLLNPEIEAEQILMSPNSYIKLQTNRDGAASLSY
RVLDGPEKVPVVHVDEKGFLASGSMIGTSTIEVIAQEPFGANQTIIVAVKVSPVSYLRVS
MSPVLHTQNKEALVAVPLGMTVTFTVHFHDNSGDVFHAHSSVLNFATNRDDFVQIGKGPT
NNTCVVRTVSVGLTLLRVWDAEHPGLSDFMPLPVLQAISPELSGAMVVGDVLCLATVLTS
LEGLSGTWSSSANSILHIDPKTGVAVARAVGSVTVYYEVAGHLRTYKEVVVSVPQRIMAR
HLHPIQTSFQEATASKVIVAVGDRSSNLRGECTPTQREVIQALHPETLISCQSQFKPAVF
DFPSQDVFTVEPQFDTALGQYFCSITMHRLTDKQRKHLSMKKTALVVSASLSSSHFSTEQ
VGAEVPFSPGLFADQAEILLSNHYTSSEIRVFGAPEVLENLEVKSGSPAVLAFAKEKSFG
WPSFITYTVGVLDPAAGSQGPLSTTLTFSSPVTNQAIAIPVTVAFVVDRRGPGPYGASLF
QHFLDSYQVMFFTLFALLAGTAVMIIAYHTVCTPRDLAVPAALTPRASPGHSPHYFAASS
PTSPNALPPARKASPPSGLWSPAYASH

Sequence length

1887

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Nucleocytoplasmic transport	ISG15 antiviral mechanism
Amyotrophic lateral sclerosis	Transport of the SLBP independent Mature mRNA
	Transport of the SLBP Dependant Mature mRNA
	Transport of Mature mRNA Derived from an Intronless Transcript
	Transport of Mature mRNA derived from an Intron-Containing Transcript
	Rev-mediated nuclear export of HIV RNA
	Transport of Ribonucleoproteins into the Host Nucleus
	NS1 Mediated Effects on Host Pathways
	Viral Messenger RNA Synthesis
	NEP/NS2 Interacts with the Cellular Export Machinery
	Regulation of Glucokinase by Glucokinase Regulatory Protein
	Vpr-mediated nuclear import of PICs
	snRNP Assembly
	SUMOylation of DNA damage response and repair proteins
	SUMOylation of ubiquitinylation proteins
	Nuclear Pore Complex (NPC) Disassembly
	Regulation of HSF1-mediated heat shock response
	SUMOylation of SUMOylation proteins
	SUMOylation of chromatin organization proteins
	SUMOylation of RNA binding proteins
	SUMOylation of DNA replication proteins
	Transcriptional regulation by small RNAs
	Defective TPR may confer susceptibility towards thyroid papillary carcinoma (TPC)
	tRNA processing in the nucleus
	HCMV Early Events
	HCMV Late Events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (17)
Acute myeloid leukemia	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONOTRUNCAL HEART MALFORMATIONS	—	GWAS catalog	28468790	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	29695241	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NUP210-related disorder	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	38374256	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	26278503	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (21)
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27042856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	LHGDN	16337775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21338529, 22282400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	28083929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22282400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22282400, 35159127	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29695241		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	29695241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	31256999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	31256999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Portal	Portal hypertension	Pubtator	39809678	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28083929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	23125866, 30854688, 37223092, 39809678, 7504063	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	LHGDN	15710222, 16337775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	31737133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	39809678	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	GWASDB_DG	21211798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	21594562, 22519587, 28083929, 30854688, 31281353, 31714880, 31737133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37686409	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21338529	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	32390360	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
NUP50	[]	27	["Nucleocytoplasmic transport","Regulation of HSF1-mediated heat shock response","HCMV Late Events","SUMOylation of DNA damage response and repair proteins","SUMOylation of chromatin organization proteins","SUMOylation of RNA binding proteins","snRNP Assembly","HCMV Early Events","Transport of the SLBP independent Mature mRNA","Transport of the SLBP Dependant Mature mRNA","Transport of Mature mRNA Derived from an Intronless Transcript","Transport of Mature mRNA derived from an Intron-Containing Transcript"]	[]
NUP42	[]	27	["Nucleocytoplasmic transport","Regulation of HSF1-mediated heat shock response","HCMV Late Events","SUMOylation of DNA damage response and repair proteins","SUMOylation of chromatin organization proteins","SUMOylation of RNA binding proteins","snRNP Assembly","HCMV Early Events","Transport of the SLBP independent Mature mRNA","Transport of the SLBP Dependant Mature mRNA","Transport of Mature mRNA Derived from an Intronless Transcript","Transport of Mature mRNA derived from an Intron-Containing Transcript"]	[]
NUP62	[]	27	["Nucleocytoplasmic transport","Regulation of HSF1-mediated heat shock response","HCMV Late Events","SUMOylation of DNA damage response and repair proteins","SUMOylation of chromatin organization proteins","SUMOylation of RNA binding proteins","snRNP Assembly","HCMV Early Events","Transport of the SLBP independent Mature mRNA","Transport of the SLBP Dependant Mature mRNA","Transport of Mature mRNA Derived from an Intronless Transcript","Transport of Mature mRNA derived from an Intron-Containing Transcript"]	[]
NUP88	[]	27	["Nucleocytoplasmic transport","Regulation of HSF1-mediated heat shock response","HCMV Late Events","SUMOylation of DNA damage response and repair proteins","SUMOylation of chromatin organization proteins","SUMOylation of RNA binding proteins","snRNP Assembly","HCMV Early Events","Transport of the SLBP independent Mature mRNA","Transport of the SLBP Dependant Mature mRNA","Transport of Mature mRNA Derived from an Intronless Transcript","Transport of Mature mRNA derived from an Intron-Containing Transcript"]	[]
NUP54	[]	27	["Nucleocytoplasmic transport","Regulation of HSF1-mediated heat shock response","HCMV Late Events","SUMOylation of DNA damage response and repair proteins","SUMOylation of chromatin organization proteins","SUMOylation of RNA binding proteins","snRNP Assembly","HCMV Early Events","Transport of the SLBP independent Mature mRNA","Transport of the SLBP Dependant Mature mRNA","Transport of Mature mRNA Derived from an Intronless Transcript","Transport of Mature mRNA derived from an Intron-Containing Transcript"]	[]

NUP210 (nucleoporin 210)

Bookmark This Gene