QRFP (pyroglutamylated RFamide peptide)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 347148
• Gene name: Pyroglutamylated RFamide peptide
• Gene symbol: QRFP
• Synonyms (NCBI Gene): 26RFa, P518
• Chromosome: 9
• Chromosome location: 9q34.12
• Summary: This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. The encoded products are members of the RFamide family of neuropeptides, characterized by their common protein C-terminus consisting of an arginine

Gene ontology (GO) Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005184	Function	Neuropeptide hormone activity	IBA
GO:0005184	Function	Neuropeptide hormone activity	IDA	14657341
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007218	Process	Neuropeptide signaling pathway	IDA	14657341
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007625	Process	Grooming behavior	IEA
GO:0007626	Process	Locomotory behavior	IEA
GO:0007626	Process	Locomotory behavior	ISS
GO:0031854	Function	Orexigenic neuropeptide QRFP receptor binding	IBA
GO:0031854	Function	Orexigenic neuropeptide QRFP receptor binding	IEA
GO:0031854	Function	Orexigenic neuropeptide QRFP receptor binding	ISS
GO:0045777	Process	Positive regulation of blood pressure	IEA
GO:0045777	Process	Positive regulation of blood pressure	ISS
GO:0060259	Process	Regulation of feeding behavior	IEA
GO:0060259	Process	Regulation of feeding behavior	ISS

Other IDs

• MIM: 609795
• HGNC: 29982
• e!Ensembl: ENSG00000188710

Protein

• UniProt ID: P83859
• Protein name: Orexigenic neuropeptide QRFP (P518) [Cleaved into: QRF-amide (Neuropeptide RF-amide) (Pyroglutamylated arginine-phenylalanine-amide peptide)]
• Protein function: Stimulates feeding behavior, metabolic rate and locomotor activity and increases blood pressure. May have orexigenic activity. May promote aldosterone secretion by the adrenal gland (By similarity). {ECO:0000250, ECO:0000269|PubMed:12960173, ECO
• PDB: 8ZH8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11109	RFamide_26RFa	5 → 135	Orexigenic neuropeptide Qrfp/P518	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed widely in the brain with highest expression levels in the cerebellum, medulla, pituitary, retina, vestibular nucleus, and white matter. Also expressed in the bladder, colon, coronary artery, parathyroid gland, prostate, testi
• Sequence:

  MVRPYPLIYFLFLPLGACFPLLDRREPTDAMGGLGAGERWADLAMGPRPHSVWGSSRWLR
  ASQPQALLVIARGLQTSGREHAGCRFRFGRQDEGSEATGFLPAAGEKTSGPLGNLAEELN
  GYSRKKGGFSFRFGRR

• Sequence length: 136

Pathways

KEGG Pathway	Reactome Pathway
Neuroactive ligand-receptor interaction	Orexin and neuropeptides FF and QRFP bind to their respective receptors
	G alpha (q) signalling events

Related Genes

Sort by: Blended Diseases Pathways Evidence source

NPFFR2 2 shared pathwaysG alpha (q) signalling events, Orexin and neuropeptides FF and QRFP bind to their respective receptors Related via 2 shared pathways including G alpha (q) signalling events, Orexin and neuropeptides FF and QRFP bind to their respective receptors. NPFFR1 2 shared pathwaysG alpha (q) signalling events, Orexin and neuropeptides FF and QRFP bind to their respective receptors Related via 2 shared pathways including G alpha (q) signalling events, Orexin and neuropeptides FF and QRFP bind to their respective receptors. QRFPR 2 shared pathwaysG alpha (q) signalling events, Orexin and neuropeptides FF and QRFP bind to their respective receptors Related via 2 shared pathways including G alpha (q) signalling events, Orexin and neuropeptides FF and QRFP bind to their respective receptors. NPFF 2 shared pathwaysG alpha (q) signalling events, Orexin and neuropeptides FF and QRFP bind to their respective receptors Related via 2 shared pathways including G alpha (q) signalling events, Orexin and neuropeptides FF and QRFP bind to their respective receptors. HCRT 2 shared pathwaysG alpha (q) signalling events, Orexin and neuropeptides FF and QRFP bind to their respective receptors Related via 2 shared pathways including G alpha (q) signalling events, Orexin and neuropeptides FF and QRFP bind to their respective receptors.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
NPFFR2	0	[]	2	["G alpha (q) signalling events","Orexin and neuropeptides FF and QRFP bind to their respective receptors"]	0	[]
NPFFR1	0	[]	2	["G alpha (q) signalling events","Orexin and neuropeptides FF and QRFP bind to their respective receptors"]	0	[]
QRFPR	0	[]	2	["G alpha (q) signalling events","Orexin and neuropeptides FF and QRFP bind to their respective receptors"]	0	[]
NPFF	0	[]	2	["G alpha (q) signalling events","Orexin and neuropeptides FF and QRFP bind to their respective receptors"]	0	[]
HCRT	0	[]	2	["G alpha (q) signalling events","Orexin and neuropeptides FF and QRFP bind to their respective receptors"]	0	[]

Diseases Linked via Similar Genes

Major depressive disorder Linked via 2 of 5 related genesNPFFR2, HCRT Central nervous system cancer Linked via 1 of 5 related genesNPFFR2 Gallbladder neoplasms Linked via 1 of 5 related genesNPFFR2 Glioblastoma Linked via 1 of 5 related genesNPFFR2 Glioma Linked via 1 of 5 related genesNPFFR2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Major depressive disorder	2	["NPFFR2","HCRT"]
Central nervous system cancer	1	["NPFFR2"]
Gallbladder neoplasms	1	["NPFFR2"]
Glioblastoma	1	["NPFFR2"]
Glioma	1	["NPFFR2"]