NPFF (neuropeptide FF-amide peptide precursor)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 8620
• Gene name: Neuropeptide FF-amide peptide precursor
• Gene symbol: NPFF
• Synonyms (NCBI Gene): FMRFAL
• Chromosome: 12
• Chromosome location: 12q13.13
• Summary: This gene encodes a member of the FMRFamide related peptide (FARP) family of neuropeptides. The encoded preproprotein is proteolytically processed to generate multiple amidated peptides. These peptides may play a role in the regulation of heart rate and b

Gene ontology (GO) Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	IBA
GO:0001664	Function	G protein-coupled receptor binding	IEA
GO:0002438	Process	Acute inflammatory response to antigenic stimulus	IEA
GO:0003254	Process	Regulation of membrane depolarization	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	TAS	9224703, 10851242
GO:0005184	Function	Neuropeptide hormone activity	IBA
GO:0005184	Function	Neuropeptide hormone activity	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IDA	11024015
GO:0007218	Process	Neuropeptide signaling pathway	IDA	11024015
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	TAS	10851242
GO:0007268	Process	Chemical synaptic transmission	TAS	9224703
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010459	Process	Negative regulation of heart rate	IEA
GO:0021510	Process	Spinal cord development	IEA
GO:0030103	Process	Vasopressin secretion	IEA
GO:0030425	Component	Dendrite	IBA
GO:0030425	Component	Dendrite	IEA
GO:0031982	Component	Vesicle	IEA
GO:0032099	Process	Negative regulation of appetite	IEA
GO:0043204	Component	Perikaryon	IBA
GO:0043204	Component	Perikaryon	IEA
GO:0043679	Component	Axon terminus	IBA
GO:0043679	Component	Axon terminus	IEA
GO:0045777	Process	Positive regulation of blood pressure	IEA
GO:0046676	Process	Negative regulation of insulin secretion	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IBA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0060135	Process	Maternal process involved in female pregnancy	IEA
GO:0070253	Process	Somatostatin secretion	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098992	Component	Neuronal dense core vesicle	IEA
GO:0160041	Function	Neuropeptide activity	IDA	11024015

Other IDs

• MIM: 604643
• HGNC: 7901
• e!Ensembl: ENSG00000139574

Protein

• UniProt ID: O15130
• Protein name: Pro-FMRFamide-related neuropeptide FF (FMRFamide-related peptides) [Cleaved into: Neuropeptide SF (NPSF); Neuropeptide FF (NPFF); Neuropeptide AF (NPAF)]
• Protein function: Morphine modulating peptides. Have wide-ranging physiologic effects, including the modulation of morphine-induced analgesia, elevation of arterial blood pressure, and increased somatostatin secretion from the pancreas. Neuropeptide FF potentiate
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15085	NPFF	21 → 113	Neuropeptide FF	Family

• Sequence:

  MDSRQAAALLVLLLLIDGGCAEGPGGQQEDQLSAEEDSEPLPPQDAQTSGSLLHYLLQAM
  ERPGRSQAFLFQPQRFGRNTQGSWRNEWLSPRAGEGLNSQFWSLAAPQRFGKK

• Sequence length: 113

Pathways

KEGG Pathway	Reactome Pathway
Neuroactive ligand-receptor interaction	Orexin and neuropeptides FF and QRFP bind to their respective receptors
	G alpha (q) signalling events

Related Genes

Sort by: Blended Diseases Pathways Evidence source

NPFFR2 2 shared pathwaysG alpha (q) signalling events, Orexin and neuropeptides FF and QRFP bind to their respective receptors Related via 2 shared pathways including G alpha (q) signalling events, Orexin and neuropeptides FF and QRFP bind to their respective receptors. QRFP 2 shared pathwaysG alpha (q) signalling events, Orexin and neuropeptides FF and QRFP bind to their respective receptors Related via 2 shared pathways including G alpha (q) signalling events, Orexin and neuropeptides FF and QRFP bind to their respective receptors. NPFFR1 2 shared pathwaysG alpha (q) signalling events, Orexin and neuropeptides FF and QRFP bind to their respective receptors Related via 2 shared pathways including G alpha (q) signalling events, Orexin and neuropeptides FF and QRFP bind to their respective receptors. QRFPR 2 shared pathwaysG alpha (q) signalling events, Orexin and neuropeptides FF and QRFP bind to their respective receptors Related via 2 shared pathways including G alpha (q) signalling events, Orexin and neuropeptides FF and QRFP bind to their respective receptors. HCRT 2 shared pathwaysG alpha (q) signalling events, Orexin and neuropeptides FF and QRFP bind to their respective receptors Related via 2 shared pathways including G alpha (q) signalling events, Orexin and neuropeptides FF and QRFP bind to their respective receptors.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
NPFFR2	0	[]	2	["G alpha (q) signalling events","Orexin and neuropeptides FF and QRFP bind to their respective receptors"]	0	[]
QRFP	0	[]	2	["G alpha (q) signalling events","Orexin and neuropeptides FF and QRFP bind to their respective receptors"]	0	[]
NPFFR1	0	[]	2	["G alpha (q) signalling events","Orexin and neuropeptides FF and QRFP bind to their respective receptors"]	0	[]
QRFPR	0	[]	2	["G alpha (q) signalling events","Orexin and neuropeptides FF and QRFP bind to their respective receptors"]	0	[]
HCRT	0	[]	2	["G alpha (q) signalling events","Orexin and neuropeptides FF and QRFP bind to their respective receptors"]	0	[]

Diseases Linked via Similar Genes

Major depressive disorder Linked via 2 of 5 related genesNPFFR2, HCRT Central nervous system cancer Linked via 1 of 5 related genesNPFFR2 Gallbladder neoplasms Linked via 1 of 5 related genesNPFFR2 Glioblastoma Linked via 1 of 5 related genesNPFFR2 Glioma Linked via 1 of 5 related genesNPFFR2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Major depressive disorder	2	["NPFFR2","HCRT"]
Central nervous system cancer	1	["NPFFR2"]
Gallbladder neoplasms	1	["NPFFR2"]
Glioblastoma	1	["NPFFR2"]
Glioma	1	["NPFFR2"]