PTH2 (parathyroid hormone 2)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 113091
Gene name Parathyroid hormone 2
Gene symbol PTH2
Synonyms (NCBI Gene)
TIP39
Chromosome 19
Chromosome location 19q13.33
Summary This gene encodes the precursor of a peptide hormone that shares sequence similarity with the parathyroid hormone. This gene is expressed in various regions of the brain where it plays a role in the release of pituitary hormones, anxiety and nociception.
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT017062 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 28514442, 33961781
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
GO:0007218 Process Neuropeptide signaling pathway IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
608386 30828 ENSG00000142538
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96A98
Protein name Tuberoinfundibular peptide of 39 residues (TIP39) (Parathyroid hormone 2)
Protein function Plays a role as a potent and selective agonist of PTH2R resulting in adenyl cyclase activation and intracellular calcium levels elevation. Induces protein kinase C beta activation, recruitment of beta-arrestin and PTH2R internalization. May inhi
PDB 7F16
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14980 TIP39 49 → 99 TIP39 peptide Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in fetal and adult brain, cerebellum and trachea. Weakly expressed in spinal cord, fetal liver, kidney and heart. {ECO:0000269|PubMed:12098667}.
Sequence 
METRQVSRSPRVRLLLLLLLLLVVPWGVRTASGVALPPVGVLSLRPPGRAWADPATPRPR
RSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Sequence length 100
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Neuroactive ligand-receptor interaction Class B/2 (Secretin family receptors)
  G alpha (s) signalling events
  ADORA2B mediated anti-inflammatory cytokines production
Sort by:
LINC02210-CRHR1 3 shared pathwaysG alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production, Class B/2 (Secretin family receptors) Related via 3 shared pathways including G alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production. PTH2R 3 shared pathwaysG alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production, Class B/2 (Secretin family receptors) Related via 3 shared pathways including G alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production. GPR83 2 shared pathwaysG alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production Related via 2 shared pathways including G alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production. GPR176 2 shared pathwaysG alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production Related via 2 shared pathways including G alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production. GPR45 2 shared pathwaysG alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production Related via 2 shared pathways including G alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production.
Autism Linked via 2 of 5 related genesLINC02210-CRHR1, PTH2R Colorectal cancer Linked via 2 of 5 related genesLINC02210-CRHR1, GPR83 Lung cancer Linked via 2 of 5 related genesLINC02210-CRHR1, PTH2R Major depressive disorder Linked via 2 of 5 related genesLINC02210-CRHR1, GPR45 Mood disorder Linked via 2 of 5 related genesLINC02210-CRHR1, PTH2R