PSPN (persephin)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 5623
Gene name Persephin
Gene symbol PSPN
Synonyms (NCBI Gene)
PSP
Chromosome 19
Chromosome location 19p13.3
Summary This gene encodes a secreted ligand of the GDNF (glial cell line-derived neurotrophic factor) subfamily and TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate the mature p
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT017516 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18 Show/Hide all (18)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding IEA
GO:0005102 Function Signaling receptor binding TAS 9491986
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
602921 9579 ENSG00000125650
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O60542
Protein name Persephin (PSP)
Protein function Growth factor that exhibits neurotrophic activity on mesencephalic dopaminergic and motor neurons (PubMed:11116144, PubMed:9491986). Acts by binding to its coreceptor, GFRA4, leading to autophosphorylation and activation of the RET receptor (Pub
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00019 TGF_beta 65 → 154 Transforming growth factor beta like domain Domain
Sequence 
MAVGKFLLGSLLLLSLQLGQGWGPDARGVPVADGEFSSEQVAKAGGTWLGTHRPLARLRR
ALSGPCQLWSLTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHG
GPCCRPTRYTDVAFLDDRHRWQRLPQLSAAACGCGG
Sequence length 156
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
MAPK signaling pathway RAF/MAP kinase cascade
PI3K-Akt signaling pathway RET signaling
Sort by:
NRTN 3 shared pathwaysMAPK signaling pathway, RAF/MAP kinase cascade, RET signaling Related via 3 shared pathways including MAPK signaling pathway, RAF/MAP kinase cascade. ARTN 3 shared pathwaysMAPK signaling pathway, RAF/MAP kinase cascade, RET signaling Related via 3 shared pathways including MAPK signaling pathway, RAF/MAP kinase cascade. GDNF 3 shared pathwaysMAPK signaling pathway, RAF/MAP kinase cascade, RET signaling Related via 3 shared pathways including MAPK signaling pathway, RAF/MAP kinase cascade. GFRA1 2 shared pathwaysRAF/MAP kinase cascade, RET signaling Related via 2 shared pathways including RAF/MAP kinase cascade, RET signaling. GFRA2 2 shared pathwaysRAF/MAP kinase cascade, RET signaling Related via 2 shared pathways including RAF/MAP kinase cascade, RET signaling.
Hirschsprung disease Linked via 3 of 5 related genesNRTN, GDNF, GFRA1 Schizophrenia Linked via 3 of 5 related genesGDNF, GFRA1, GFRA2 Major depressive disorder Linked via 2 of 5 related genesARTN, GDNF Depression Linked via 2 of 5 related genesARTN, GDNF Epilepsy Linked via 2 of 5 related genesGDNF, GFRA1