PRXL2A (peroxiredoxin like 2A)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 84293
Gene name Peroxiredoxin like 2A
Gene symbol PRXL2A
Synonyms (NCBI Gene)
AdrxC10orf58FAM213APAMM
Chromosome 10
Chromosome location 10q23.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IDA 19951071
GO:0005737 Component Cytoplasm IEA
GO:0016209 Function Antioxidant activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
617165 28651 ENSG00000122378
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BRX8
Protein name Peroxiredoxin-like 2A (Peroxiredoxin-like 2 activated in M-CSF stimulated monocytes) (Protein PAMM) (Redox-regulatory protein FAM213A)
Protein function Involved in redox regulation of the cell (PubMed:19951071, PubMed:26438880). Acts as an antioxidant (PubMed:19951071, PubMed:26438880). Inhibits TNFSF11-induced NFKB1 and JUN activation and osteoclast differentiation (PubMed:19951071). May affec
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13911 AhpC-TSA_2 94 → 202 AhpC/TSA antioxidant enzyme Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in CSF1 and TNFSF11-stimulated CD14(+) peripheral blood mononuclear cells (PBMCs). {ECO:0000269|PubMed:19951071}.
Sequence 
MSFLQDPSFFTMGMWSIGAGALGAAALALLLANTDVFLSKPQKAALEYLEDIDLKTLEKE
PRTFKAKELWEKNGAVIMAVRRPGCFLCREEAADLSSLKSMLDQLGVPLYAVVKEHIRTE
VKDFQPYFKGEIFLDEKKKFYGPQRRKMMFMGFIRLGVWYNFFRAWNGGFSGNLEGEGFI
LGGVFVVGSGKQGILLEHREKEFGDKVNLLSVLEAAKMIKPQTLASEKK
Sequence length 229
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
7
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Show/Hide Unknown Diseases (7)
Phenotype Name Clinical Significance Source Reference Evidence Score
ATRIAL FIBRILLATION — GWAS catalog 40645996
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CATARACT — GWAS catalog 34594039
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
GOUT — GWAS catalog 33356394
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
HEART FAILURE — GWAS catalog 40195560
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
HYPERTENSION — GWAS catalog 37947095
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Disorder of macula of retina Disorder Of Macula Of Retina BEFREE 30257961
★★★★★
★☆☆☆☆
Found in Text Mining only
Head and Neck Carcinoma Head And Neck Carcinoma BEFREE 27221705
★★★★★
★☆☆☆☆
Found in Text Mining only
Leukemia, Myelocytic, Acute Leukemia GWASCAT_DG 27903959
★★★★★
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 27221705
★★★★★
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 27221705
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
KRTCAP2 2 shared diseasesCataract, Peptic ulcer disease 2 shared evidence sourcesGWAS catalog (Cataract), GWAS catalog (Peptic ulcer disease) Related via 2 shared diseases including Cataract, Peptic ulcer disease — evidence mostly GWAS catalog. HORMAD2 2 shared diseasesCataract, Peptic ulcer disease 2 shared evidence sourcesGWAS catalog (Cataract), GWAS catalog (Peptic ulcer disease) Related via 2 shared diseases including Cataract, Peptic ulcer disease — evidence mostly GWAS catalog. RARB 3 shared diseasesCataract, Peptic ulcer disease, Sarcoidosis 4 shared evidence sourcesGWAS catalog (Cataract), GWAS catalog (Heart failure), GWAS catalog (Peptic ulcer disease), GWAS catalog (Sarcoidosis) Related via 3 shared diseases including Cataract, Peptic ulcer disease — evidence mostly GWAS catalog. FBXL20 1 shared diseasePeptic ulcer disease 2 shared evidence sourcesGWAS catalog (Heart failure), GWAS catalog (Peptic ulcer disease) Related via 1 shared disease including Peptic ulcer disease — evidence mostly GWAS catalog. TSPAN14 1 shared diseasePeptic ulcer disease 2 shared evidence sourcesGWAS catalog (Heart failure), GWAS catalog (Peptic ulcer disease) Related via 1 shared disease including Peptic ulcer disease — evidence mostly GWAS catalog.
Crohn disease Linked via 4 of 5 related genesKRTCAP2, HORMAD2, RARB, TSPAN14 Alzheimer disease Linked via 3 of 5 related genesKRTCAP2, RARB, TSPAN14 Ulcerative colitis Linked via 3 of 5 related genesKRTCAP2, HORMAD2, TSPAN14 Schizophrenia Linked via 3 of 5 related genesHORMAD2, RARB, FBXL20 Diabetes mellitus type 2 Linked via 3 of 5 related genesHORMAD2, RARB, FBXL20