Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	5563
Gene name	Protein kinase AMP-activated catalytic subunit alpha 2
Gene symbol	PRKAA2
Synonyms (NCBI Gene)	AMPKAMPK2AMPKa2PRKAA
Chromosome	1
Chromosome location	1p32.2
Summary	The protein encoded by this gene is a catalytic subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that

561

Show/Hide all (561)

miRTarBase ID	miRNA	Experiments	Reference
MIRT026874	hsa-miR-192-5p	Microarray	19074876
MIRT027841	hsa-miR-98-5p	Microarray	19088304
MIRT052107	hsa-let-7b-5p	CLASH	23622248
MIRT047217	hsa-miR-182-5p	CLASH	23622248
MIRT700623	hsa-miR-495-5p	HITS-CLIP	23313552
MIRT700622	hsa-miR-4761-5p	HITS-CLIP	23313552
MIRT700621	hsa-miR-8060	HITS-CLIP	23313552
MIRT700620	hsa-miR-494-3p	HITS-CLIP	23313552
MIRT700619	hsa-miR-3166	HITS-CLIP	23313552
MIRT700618	hsa-miR-4771	HITS-CLIP	23313552
MIRT700617	hsa-miR-3653-3p	HITS-CLIP	23313552
MIRT700616	hsa-miR-7154-5p	HITS-CLIP	23313552
MIRT700615	hsa-miR-1273h-3p	HITS-CLIP	23313552
MIRT700614	hsa-miR-3678-3p	HITS-CLIP	23313552
MIRT700613	hsa-miR-3658	HITS-CLIP	23313552
MIRT654776	hsa-miR-141-3p	HITS-CLIP	23824327
MIRT654775	hsa-miR-200a-3p	HITS-CLIP	23824327
MIRT654774	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT654773	hsa-miR-382-3p	HITS-CLIP	23824327
MIRT654772	hsa-miR-4719	HITS-CLIP	23824327
MIRT654771	hsa-miR-4729	HITS-CLIP	23824327
MIRT654770	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT654769	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT449658	hsa-miR-5696	HITS-CLIP	23824327
MIRT654768	hsa-miR-302c-5p	HITS-CLIP	23824327
MIRT555220	hsa-miR-7844-5p	PAR-CLIP	21572407
MIRT281967	hsa-miR-4804-3p	PAR-CLIP	21572407
MIRT281965	hsa-miR-4720-3p	PAR-CLIP	21572407
MIRT449663	hsa-miR-1250-3p	PAR-CLIP	22100165
MIRT449662	hsa-miR-153-5p	PAR-CLIP	22100165
MIRT449661	hsa-miR-26b-3p	PAR-CLIP	22100165
MIRT449660	hsa-miR-4635	PAR-CLIP	22100165
MIRT449659	hsa-miR-1206	PAR-CLIP	22100165
MIRT449657	hsa-miR-6853-3p	PAR-CLIP	22100165
MIRT449658	hsa-miR-5696	PAR-CLIP	22100165
MIRT449656	hsa-miR-579-3p	PAR-CLIP	22100165
MIRT449655	hsa-miR-664b-3p	PAR-CLIP	22100165
MIRT449654	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT449653	hsa-miR-578	PAR-CLIP	22100165
MIRT449652	hsa-miR-510-3p	PAR-CLIP	22100165
MIRT731819	hsa-miR-27a-3p	Luciferase reporter assayWestern blot	27779715
MIRT731819	hsa-miR-27a-3p	Luciferase reporter assayWestern blot	27779715
MIRT734738	hsa-miR-124-3p	Luciferase reporter assayMicroarray	33681194
MIRT700623	hsa-miR-495-5p	HITS-CLIP	23313552
MIRT700622	hsa-miR-4761-5p	HITS-CLIP	23313552
MIRT700621	hsa-miR-8060	HITS-CLIP	23313552
MIRT700620	hsa-miR-494-3p	HITS-CLIP	23313552
MIRT700619	hsa-miR-3166	HITS-CLIP	23313552
MIRT700618	hsa-miR-4771	HITS-CLIP	23313552
MIRT700617	hsa-miR-3653-3p	HITS-CLIP	23313552
MIRT700616	hsa-miR-7154-5p	HITS-CLIP	23313552
MIRT700615	hsa-miR-1273h-3p	HITS-CLIP	23313552
MIRT700614	hsa-miR-3678-3p	HITS-CLIP	23313552
MIRT700613	hsa-miR-3658	HITS-CLIP	23313552
MIRT654776	hsa-miR-141-3p	HITS-CLIP	23824327
MIRT654775	hsa-miR-200a-3p	HITS-CLIP	23824327
MIRT654774	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT654773	hsa-miR-382-3p	HITS-CLIP	23824327
MIRT654772	hsa-miR-4719	HITS-CLIP	23824327
MIRT654771	hsa-miR-4729	HITS-CLIP	23824327
MIRT654770	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT654769	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT449658	hsa-miR-5696	HITS-CLIP	23824327
MIRT654768	hsa-miR-302c-5p	HITS-CLIP	23824327
MIRT555220	hsa-miR-7844-5p	PAR-CLIP	21572407
MIRT281967	hsa-miR-4804-3p	PAR-CLIP	21572407
MIRT281965	hsa-miR-4720-3p	PAR-CLIP	21572407
MIRT449663	hsa-miR-1250-3p	PAR-CLIP	22100165
MIRT449662	hsa-miR-153-5p	PAR-CLIP	22100165
MIRT449661	hsa-miR-26b-3p	PAR-CLIP	22100165
MIRT449660	hsa-miR-4635	PAR-CLIP	22100165
MIRT449659	hsa-miR-1206	PAR-CLIP	22100165
MIRT449657	hsa-miR-6853-3p	PAR-CLIP	22100165
MIRT449658	hsa-miR-5696	PAR-CLIP	22100165
MIRT449656	hsa-miR-579-3p	PAR-CLIP	22100165
MIRT449655	hsa-miR-664b-3p	PAR-CLIP	22100165
MIRT449654	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT449653	hsa-miR-578	PAR-CLIP	22100165
MIRT449652	hsa-miR-510-3p	PAR-CLIP	22100165
MIRT739556	hsa-miR-10a	CLIP-seq
MIRT739555	hsa-miR-10b	CLIP-seq
MIRT1261931	hsa-miR-1208	CLIP-seq
MIRT1261932	hsa-miR-1265	CLIP-seq
MIRT1261933	hsa-miR-1267	CLIP-seq
MIRT1261934	hsa-miR-128	CLIP-seq
MIRT1261935	hsa-miR-1283	CLIP-seq
MIRT1261936	hsa-miR-1286	CLIP-seq
MIRT1261937	hsa-miR-1288	CLIP-seq
MIRT1261938	hsa-miR-129-5p	CLIP-seq
MIRT1261939	hsa-miR-130a	CLIP-seq
MIRT1261940	hsa-miR-130b	CLIP-seq
MIRT1261941	hsa-miR-134	CLIP-seq
MIRT1261942	hsa-miR-137	CLIP-seq
MIRT1261943	hsa-miR-1827	CLIP-seq
MIRT1261944	hsa-miR-186	CLIP-seq
MIRT1261945	hsa-miR-1915	CLIP-seq
MIRT739557	hsa-miR-203	CLIP-seq
MIRT1261946	hsa-miR-2053	CLIP-seq
MIRT1261947	hsa-miR-214	CLIP-seq
MIRT1261948	hsa-miR-216b	CLIP-seq
MIRT1261949	hsa-miR-218	CLIP-seq
MIRT1261950	hsa-miR-2392	CLIP-seq
MIRT1261951	hsa-miR-25	CLIP-seq
MIRT1261952	hsa-miR-27a	CLIP-seq
MIRT1261953	hsa-miR-27b	CLIP-seq
MIRT1261954	hsa-miR-301a	CLIP-seq
MIRT1261955	hsa-miR-301b	CLIP-seq
MIRT1261956	hsa-miR-3118	CLIP-seq
MIRT1261957	hsa-miR-3157-3p	CLIP-seq
MIRT1261958	hsa-miR-3164	CLIP-seq
MIRT1261959	hsa-miR-3169	CLIP-seq
MIRT1261960	hsa-miR-3173-3p	CLIP-seq
MIRT1261961	hsa-miR-32	CLIP-seq
MIRT1261962	hsa-miR-320a	CLIP-seq
MIRT1261963	hsa-miR-320b	CLIP-seq
MIRT1261964	hsa-miR-320c	CLIP-seq
MIRT1261965	hsa-miR-320d	CLIP-seq
MIRT1261966	hsa-miR-323-3p	CLIP-seq
MIRT1261967	hsa-miR-330-3p	CLIP-seq
MIRT1261968	hsa-miR-335	CLIP-seq
MIRT1261969	hsa-miR-34c-3p	CLIP-seq
MIRT1261970	hsa-miR-3591-3p	CLIP-seq
MIRT1261971	hsa-miR-3611	CLIP-seq
MIRT1261972	hsa-miR-3612	CLIP-seq
MIRT1261973	hsa-miR-3613-3p	CLIP-seq
MIRT1261974	hsa-miR-3619-5p	CLIP-seq
MIRT1261975	hsa-miR-3622b-5p	CLIP-seq
MIRT1261976	hsa-miR-362-5p	CLIP-seq
MIRT1261977	hsa-miR-363	CLIP-seq
MIRT1261978	hsa-miR-3646	CLIP-seq
MIRT1261979	hsa-miR-3666	CLIP-seq
MIRT1261980	hsa-miR-367	CLIP-seq
MIRT1261981	hsa-miR-3672	CLIP-seq
MIRT1261982	hsa-miR-3674	CLIP-seq
MIRT1261983	hsa-miR-3685	CLIP-seq
MIRT1261984	hsa-miR-3691-3p	CLIP-seq
MIRT1261985	hsa-miR-376a	CLIP-seq
MIRT1261986	hsa-miR-376b	CLIP-seq
MIRT1261987	hsa-miR-3919	CLIP-seq
MIRT1261988	hsa-miR-410	CLIP-seq
MIRT1261989	hsa-miR-4266	CLIP-seq
MIRT1261990	hsa-miR-4282	CLIP-seq
MIRT1261991	hsa-miR-4295	CLIP-seq
MIRT1261992	hsa-miR-4326	CLIP-seq
MIRT1261993	hsa-miR-4427	CLIP-seq
MIRT1261994	hsa-miR-4428	CLIP-seq
MIRT1261995	hsa-miR-4429	CLIP-seq
MIRT1261996	hsa-miR-4477a	CLIP-seq
MIRT1261997	hsa-miR-4501	CLIP-seq
MIRT1261998	hsa-miR-4521	CLIP-seq
MIRT1261999	hsa-miR-454	CLIP-seq
MIRT1262000	hsa-miR-4671-3p	CLIP-seq
MIRT1262001	hsa-miR-4680-3p	CLIP-seq
MIRT1262002	hsa-miR-4694-3p	CLIP-seq
MIRT1262003	hsa-miR-4694-5p	CLIP-seq
MIRT1262004	hsa-miR-4695-5p	CLIP-seq
MIRT1262005	hsa-miR-4709-3p	CLIP-seq
MIRT1262006	hsa-miR-4726-3p	CLIP-seq
MIRT1262007	hsa-miR-4738-3p	CLIP-seq
MIRT1262008	hsa-miR-4756-3p	CLIP-seq
MIRT1262009	hsa-miR-4764-5p	CLIP-seq
MIRT1262010	hsa-miR-4768-3p	CLIP-seq
MIRT1262011	hsa-miR-4775	CLIP-seq
MIRT1262012	hsa-miR-4779	CLIP-seq
MIRT1262013	hsa-miR-4793-5p	CLIP-seq
MIRT1262014	hsa-miR-4803	CLIP-seq
MIRT1262015	hsa-miR-494	CLIP-seq
MIRT1262016	hsa-miR-500b	CLIP-seq
MIRT1262017	hsa-miR-501-5p	CLIP-seq
MIRT1262018	hsa-miR-513a-5p	CLIP-seq
MIRT1262019	hsa-miR-548ae	CLIP-seq
MIRT1262020	hsa-miR-548ag	CLIP-seq
MIRT1262021	hsa-miR-548ai	CLIP-seq
MIRT1262022	hsa-miR-548aj	CLIP-seq
MIRT1262023	hsa-miR-548am	CLIP-seq
MIRT1262024	hsa-miR-548c-3p	CLIP-seq
MIRT1262025	hsa-miR-548x	CLIP-seq
MIRT1262026	hsa-miR-569	CLIP-seq
MIRT1262027	hsa-miR-579	CLIP-seq
MIRT1262028	hsa-miR-581	CLIP-seq
MIRT1262029	hsa-miR-589	CLIP-seq
MIRT1262030	hsa-miR-599	CLIP-seq
MIRT1262031	hsa-miR-606	CLIP-seq
MIRT1262032	hsa-miR-616	CLIP-seq
MIRT1262033	hsa-miR-642b	CLIP-seq
MIRT1262034	hsa-miR-650	CLIP-seq
MIRT1262035	hsa-miR-670	CLIP-seq
MIRT1262036	hsa-miR-758	CLIP-seq
MIRT1262037	hsa-miR-761	CLIP-seq
MIRT1262038	hsa-miR-92a	CLIP-seq
MIRT1262039	hsa-miR-92b	CLIP-seq
MIRT1262040	hsa-miR-944	CLIP-seq
MIRT2077186	hsa-miR-1246	CLIP-seq
MIRT2077187	hsa-miR-1290	CLIP-seq
MIRT1261938	hsa-miR-129-5p	CLIP-seq
MIRT2077188	hsa-miR-1299	CLIP-seq
MIRT739557	hsa-miR-203	CLIP-seq
MIRT1261947	hsa-miR-214	CLIP-seq
MIRT1261958	hsa-miR-3164	CLIP-seq
MIRT2077189	hsa-miR-3167	CLIP-seq
MIRT1261974	hsa-miR-3619-5p	CLIP-seq
MIRT1261975	hsa-miR-3622b-5p	CLIP-seq
MIRT2077190	hsa-miR-375	CLIP-seq
MIRT2077191	hsa-miR-3977	CLIP-seq
MIRT2077192	hsa-miR-4291	CLIP-seq
MIRT2077193	hsa-miR-4307	CLIP-seq
MIRT1261992	hsa-miR-4326	CLIP-seq
MIRT2077194	hsa-miR-4503	CLIP-seq
MIRT2077195	hsa-miR-4691-5p	CLIP-seq
MIRT2077196	hsa-miR-4720-5p	CLIP-seq
MIRT1262011	hsa-miR-4775	CLIP-seq
MIRT2077197	hsa-miR-4799-3p	CLIP-seq
MIRT2077198	hsa-miR-548aa	CLIP-seq
MIRT2077199	hsa-miR-548ac	CLIP-seq
MIRT1262019	hsa-miR-548ae	CLIP-seq
MIRT1262022	hsa-miR-548aj	CLIP-seq
MIRT1262023	hsa-miR-548am	CLIP-seq
MIRT2077200	hsa-miR-548d-3p	CLIP-seq
MIRT1262025	hsa-miR-548x	CLIP-seq
MIRT2077201	hsa-miR-548z	CLIP-seq
MIRT2077202	hsa-miR-561	CLIP-seq
MIRT2077203	hsa-miR-582-3p	CLIP-seq
MIRT2077204	hsa-miR-607	CLIP-seq
MIRT1262037	hsa-miR-761	CLIP-seq
MIRT2077205	hsa-miR-876-5p	CLIP-seq
MIRT2077206	hsa-miR-922	CLIP-seq
MIRT2303658	hsa-let-7a	CLIP-seq
MIRT2303659	hsa-let-7b	CLIP-seq
MIRT2303660	hsa-let-7c	CLIP-seq
MIRT2303661	hsa-let-7d	CLIP-seq
MIRT2303662	hsa-let-7e	CLIP-seq
MIRT2303663	hsa-let-7f	CLIP-seq
MIRT2303664	hsa-let-7g	CLIP-seq
MIRT2303665	hsa-let-7i	CLIP-seq
MIRT2303666	hsa-miR-106a	CLIP-seq
MIRT2303667	hsa-miR-106b	CLIP-seq
MIRT1261932	hsa-miR-1265	CLIP-seq
MIRT2303668	hsa-miR-1284	CLIP-seq
MIRT1261936	hsa-miR-1286	CLIP-seq
MIRT1261937	hsa-miR-1288	CLIP-seq
MIRT2303669	hsa-miR-1294	CLIP-seq
MIRT1261939	hsa-miR-130a	CLIP-seq
MIRT1261940	hsa-miR-130b	CLIP-seq
MIRT2303670	hsa-miR-141	CLIP-seq
MIRT2303671	hsa-miR-142-5p	CLIP-seq
MIRT2303672	hsa-miR-154	CLIP-seq
MIRT2303673	hsa-miR-17	CLIP-seq
MIRT2303674	hsa-miR-181a	CLIP-seq
MIRT2303675	hsa-miR-181b	CLIP-seq
MIRT2303676	hsa-miR-181c	CLIP-seq
MIRT2303677	hsa-miR-181d	CLIP-seq
MIRT2303678	hsa-miR-200a	CLIP-seq
MIRT2303679	hsa-miR-202	CLIP-seq
MIRT2303680	hsa-miR-20a	CLIP-seq
MIRT2303681	hsa-miR-20b	CLIP-seq
MIRT1261947	hsa-miR-214	CLIP-seq
MIRT1261950	hsa-miR-2392	CLIP-seq
MIRT2303682	hsa-miR-23a	CLIP-seq
MIRT2303683	hsa-miR-23b	CLIP-seq
MIRT2303684	hsa-miR-23c	CLIP-seq
MIRT1261951	hsa-miR-25	CLIP-seq
MIRT2303685	hsa-miR-300	CLIP-seq
MIRT1261954	hsa-miR-301a	CLIP-seq
MIRT1261955	hsa-miR-301b	CLIP-seq
MIRT2303686	hsa-miR-302a	CLIP-seq
MIRT2303687	hsa-miR-302b	CLIP-seq
MIRT2303688	hsa-miR-302c	CLIP-seq
MIRT2303689	hsa-miR-302d	CLIP-seq
MIRT2303690	hsa-miR-302e	CLIP-seq
MIRT2303691	hsa-miR-31	CLIP-seq
MIRT2303692	hsa-miR-3143	CLIP-seq
MIRT2303693	hsa-miR-3145-3p	CLIP-seq
MIRT2303694	hsa-miR-3163	CLIP-seq
MIRT1261958	hsa-miR-3164	CLIP-seq
MIRT1261959	hsa-miR-3169	CLIP-seq
MIRT2303695	hsa-miR-3194-5p	CLIP-seq
MIRT1261961	hsa-miR-32	CLIP-seq
MIRT1261962	hsa-miR-320a	CLIP-seq
MIRT1261963	hsa-miR-320b	CLIP-seq
MIRT1261964	hsa-miR-320c	CLIP-seq
MIRT1261965	hsa-miR-320d	CLIP-seq
MIRT2303696	hsa-miR-340	CLIP-seq
MIRT1261969	hsa-miR-34c-3p	CLIP-seq
MIRT1261974	hsa-miR-3619-5p	CLIP-seq
MIRT1261975	hsa-miR-3622b-5p	CLIP-seq
MIRT1261977	hsa-miR-363	CLIP-seq
MIRT1261979	hsa-miR-3666	CLIP-seq
MIRT1261980	hsa-miR-367	CLIP-seq
MIRT1261984	hsa-miR-3691-3p	CLIP-seq
MIRT2303697	hsa-miR-372	CLIP-seq
MIRT2303698	hsa-miR-373	CLIP-seq
MIRT2077190	hsa-miR-375	CLIP-seq
MIRT1261985	hsa-miR-376a	CLIP-seq
MIRT1261986	hsa-miR-376b	CLIP-seq
MIRT2303699	hsa-miR-381	CLIP-seq
MIRT2303700	hsa-miR-3945	CLIP-seq
MIRT2303701	hsa-miR-3973	CLIP-seq
MIRT2303702	hsa-miR-4262	CLIP-seq
MIRT2303703	hsa-miR-4276	CLIP-seq
MIRT1261990	hsa-miR-4282	CLIP-seq
MIRT1261991	hsa-miR-4295	CLIP-seq
MIRT2303704	hsa-miR-4311	CLIP-seq
MIRT2303705	hsa-miR-4316	CLIP-seq
MIRT2303706	hsa-miR-4420	CLIP-seq
MIRT1261995	hsa-miR-4429	CLIP-seq
MIRT2303707	hsa-miR-4458	CLIP-seq
MIRT2303708	hsa-miR-4464	CLIP-seq
MIRT2303709	hsa-miR-4495	CLIP-seq
MIRT2303710	hsa-miR-4500	CLIP-seq
MIRT2303711	hsa-miR-452	CLIP-seq
MIRT1261999	hsa-miR-454	CLIP-seq
MIRT2303712	hsa-miR-4642	CLIP-seq
MIRT2303713	hsa-miR-4666-3p	CLIP-seq
MIRT1262000	hsa-miR-4671-3p	CLIP-seq
MIRT2303714	hsa-miR-4676-3p	CLIP-seq
MIRT2303715	hsa-miR-4677-3p	CLIP-seq
MIRT2303716	hsa-miR-4677-5p	CLIP-seq
MIRT2303717	hsa-miR-4679	CLIP-seq
MIRT2303718	hsa-miR-4693-5p	CLIP-seq
MIRT2303719	hsa-miR-4704-3p	CLIP-seq
MIRT2303720	hsa-miR-4705	CLIP-seq
MIRT2077196	hsa-miR-4720-5p	CLIP-seq
MIRT1262007	hsa-miR-4738-3p	CLIP-seq
MIRT2303721	hsa-miR-4748	CLIP-seq
MIRT2303722	hsa-miR-4773	CLIP-seq
MIRT2303723	hsa-miR-4795-3p	CLIP-seq
MIRT2077197	hsa-miR-4799-3p	CLIP-seq
MIRT2303724	hsa-miR-512-3p	CLIP-seq
MIRT2303725	hsa-miR-519d	CLIP-seq
MIRT2303726	hsa-miR-520a-3p	CLIP-seq
MIRT2303727	hsa-miR-520b	CLIP-seq
MIRT2303728	hsa-miR-520c-3p	CLIP-seq
MIRT2303729	hsa-miR-520d-3p	CLIP-seq
MIRT2303730	hsa-miR-520e	CLIP-seq
MIRT2303731	hsa-miR-520g	CLIP-seq
MIRT2303732	hsa-miR-520h	CLIP-seq
MIRT1262024	hsa-miR-548c-3p	CLIP-seq
MIRT2303733	hsa-miR-548m	CLIP-seq
MIRT2303734	hsa-miR-633	CLIP-seq
MIRT2303735	hsa-miR-759	CLIP-seq
MIRT1262037	hsa-miR-761	CLIP-seq
MIRT1262038	hsa-miR-92a	CLIP-seq
MIRT1262039	hsa-miR-92b	CLIP-seq
MIRT2303736	hsa-miR-93	CLIP-seq
MIRT2303737	hsa-miR-98	CLIP-seq
MIRT2077188	hsa-miR-1299	CLIP-seq
MIRT2392964	hsa-miR-147	CLIP-seq
MIRT2392965	hsa-miR-4289	CLIP-seq
MIRT2392966	hsa-miR-4470	CLIP-seq
MIRT2392967	hsa-miR-4749-3p	CLIP-seq
MIRT2392968	hsa-miR-875-3p	CLIP-seq
MIRT2303722	hsa-miR-4773	CLIP-seq
MIRT1262019	hsa-miR-548ae	CLIP-seq
MIRT1262022	hsa-miR-548aj	CLIP-seq
MIRT1262023	hsa-miR-548am	CLIP-seq
MIRT1262025	hsa-miR-548x	CLIP-seq
MIRT2303674	hsa-miR-181a	CLIP-seq
MIRT2303675	hsa-miR-181b	CLIP-seq
MIRT2303676	hsa-miR-181c	CLIP-seq
MIRT2303677	hsa-miR-181d	CLIP-seq
MIRT2465908	hsa-miR-3938	CLIP-seq
MIRT2303702	hsa-miR-4262	CLIP-seq
MIRT2303658	hsa-let-7a	CLIP-seq
MIRT2303659	hsa-let-7b	CLIP-seq
MIRT2303660	hsa-let-7c	CLIP-seq
MIRT2303661	hsa-let-7d	CLIP-seq
MIRT2303662	hsa-let-7e	CLIP-seq
MIRT2303663	hsa-let-7f	CLIP-seq
MIRT2303664	hsa-let-7g	CLIP-seq
MIRT2303665	hsa-let-7i	CLIP-seq
MIRT1261931	hsa-miR-1208	CLIP-seq
MIRT2077186	hsa-miR-1246	CLIP-seq
MIRT2600382	hsa-miR-1255a	CLIP-seq
MIRT2600383	hsa-miR-1255b	CLIP-seq
MIRT2600384	hsa-miR-1256	CLIP-seq
MIRT1261933	hsa-miR-1267	CLIP-seq
MIRT2303669	hsa-miR-1294	CLIP-seq
MIRT1261942	hsa-miR-137	CLIP-seq
MIRT2600385	hsa-miR-139-5p	CLIP-seq
MIRT2303672	hsa-miR-154	CLIP-seq
MIRT2600386	hsa-miR-1913	CLIP-seq
MIRT1261945	hsa-miR-1915	CLIP-seq
MIRT2600387	hsa-miR-197	CLIP-seq
MIRT2303679	hsa-miR-202	CLIP-seq
MIRT739557	hsa-miR-203	CLIP-seq
MIRT1261948	hsa-miR-216b	CLIP-seq
MIRT1261951	hsa-miR-25	CLIP-seq
MIRT2600388	hsa-miR-3065-5p	CLIP-seq
MIRT2600389	hsa-miR-30a	CLIP-seq
MIRT2600390	hsa-miR-30b	CLIP-seq
MIRT2600391	hsa-miR-30c	CLIP-seq
MIRT2600392	hsa-miR-30d	CLIP-seq
MIRT2600393	hsa-miR-30e	CLIP-seq
MIRT2600394	hsa-miR-3133	CLIP-seq
MIRT2303692	hsa-miR-3143	CLIP-seq
MIRT2600395	hsa-miR-3148	CLIP-seq
MIRT2600396	hsa-miR-3155	CLIP-seq
MIRT2600397	hsa-miR-3155b	CLIP-seq
MIRT1261958	hsa-miR-3164	CLIP-seq
MIRT2600398	hsa-miR-3185	CLIP-seq
MIRT2600399	hsa-miR-3187-3p	CLIP-seq
MIRT2600400	hsa-miR-3199	CLIP-seq
MIRT1261961	hsa-miR-32	CLIP-seq
MIRT2600401	hsa-miR-324-3p	CLIP-seq
MIRT1261968	hsa-miR-335	CLIP-seq
MIRT2600402	hsa-miR-33a	CLIP-seq
MIRT2600403	hsa-miR-33b	CLIP-seq
MIRT2600404	hsa-miR-34a	CLIP-seq
MIRT1261969	hsa-miR-34c-3p	CLIP-seq
MIRT2600405	hsa-miR-34c-5p	CLIP-seq
MIRT1261973	hsa-miR-3613-3p	CLIP-seq
MIRT2600406	hsa-miR-361-5p	CLIP-seq
MIRT1261975	hsa-miR-3622b-5p	CLIP-seq
MIRT1261977	hsa-miR-363	CLIP-seq
MIRT1261978	hsa-miR-3646	CLIP-seq
MIRT2600407	hsa-miR-3663-5p	CLIP-seq
MIRT1261980	hsa-miR-367	CLIP-seq
MIRT2600408	hsa-miR-3688-3p	CLIP-seq
MIRT2600409	hsa-miR-374c	CLIP-seq
MIRT2600410	hsa-miR-377	CLIP-seq
MIRT2077191	hsa-miR-3977	CLIP-seq
MIRT2600411	hsa-miR-411	CLIP-seq
MIRT2600412	hsa-miR-4293	CLIP-seq
MIRT2600413	hsa-miR-4305	CLIP-seq
MIRT2303705	hsa-miR-4316	CLIP-seq
MIRT2600414	hsa-miR-4320	CLIP-seq
MIRT2600415	hsa-miR-4327	CLIP-seq
MIRT2600416	hsa-miR-4328	CLIP-seq
MIRT2600417	hsa-miR-4435	CLIP-seq
MIRT2600418	hsa-miR-4438	CLIP-seq
MIRT2600419	hsa-miR-4453	CLIP-seq
MIRT2303707	hsa-miR-4458	CLIP-seq
MIRT2600420	hsa-miR-4463	CLIP-seq
MIRT2600421	hsa-miR-4474-5p	CLIP-seq
MIRT2600422	hsa-miR-4475	CLIP-seq
MIRT2600423	hsa-miR-4477b	CLIP-seq
MIRT2600424	hsa-miR-4494	CLIP-seq
MIRT2600425	hsa-miR-449a	CLIP-seq
MIRT2600426	hsa-miR-449b	CLIP-seq
MIRT2303710	hsa-miR-4500	CLIP-seq
MIRT2077194	hsa-miR-4503	CLIP-seq
MIRT2600427	hsa-miR-4538	CLIP-seq
MIRT2600428	hsa-miR-4641	CLIP-seq
MIRT2600429	hsa-miR-4650-5p	CLIP-seq
MIRT2600430	hsa-miR-4668-3p	CLIP-seq
MIRT2303715	hsa-miR-4677-3p	CLIP-seq
MIRT2303717	hsa-miR-4679	CLIP-seq
MIRT2600431	hsa-miR-4684-3p	CLIP-seq
MIRT2600432	hsa-miR-4686	CLIP-seq
MIRT2600433	hsa-miR-4687-3p	CLIP-seq
MIRT2600434	hsa-miR-4698	CLIP-seq
MIRT2600435	hsa-miR-4701-5p	CLIP-seq
MIRT2600436	hsa-miR-4708-3p	CLIP-seq
MIRT2600437	hsa-miR-4716-5p	CLIP-seq
MIRT2077196	hsa-miR-4720-5p	CLIP-seq
MIRT1262006	hsa-miR-4726-3p	CLIP-seq
MIRT1262007	hsa-miR-4738-3p	CLIP-seq
MIRT1262010	hsa-miR-4768-3p	CLIP-seq
MIRT1262011	hsa-miR-4775	CLIP-seq
MIRT2600438	hsa-miR-4777-5p	CLIP-seq
MIRT2600439	hsa-miR-4781-3p	CLIP-seq
MIRT2303723	hsa-miR-4795-3p	CLIP-seq
MIRT2077197	hsa-miR-4799-3p	CLIP-seq
MIRT2600440	hsa-miR-484	CLIP-seq
MIRT2600441	hsa-miR-5095	CLIP-seq
MIRT2600442	hsa-miR-5096	CLIP-seq
MIRT2600443	hsa-miR-518a-5p	CLIP-seq
MIRT2600444	hsa-miR-518d-5p	CLIP-seq
MIRT2600445	hsa-miR-519b-5p	CLIP-seq
MIRT2600446	hsa-miR-519c-5p	CLIP-seq
MIRT2600447	hsa-miR-520c-5p	CLIP-seq
MIRT2600448	hsa-miR-526a	CLIP-seq
MIRT2600449	hsa-miR-527	CLIP-seq
MIRT2600450	hsa-miR-543	CLIP-seq
MIRT1262019	hsa-miR-548ae	CLIP-seq
MIRT1262022	hsa-miR-548aj	CLIP-seq
MIRT1262023	hsa-miR-548am	CLIP-seq
MIRT2600451	hsa-miR-548s	CLIP-seq
MIRT1262025	hsa-miR-548x	CLIP-seq
MIRT1262027	hsa-miR-579	CLIP-seq
MIRT2600452	hsa-miR-588	CLIP-seq
MIRT2600453	hsa-miR-590-3p	CLIP-seq
MIRT2600454	hsa-miR-618	CLIP-seq
MIRT2600455	hsa-miR-622	CLIP-seq
MIRT1262033	hsa-miR-642b	CLIP-seq
MIRT2600456	hsa-miR-655	CLIP-seq
MIRT1262038	hsa-miR-92a	CLIP-seq
MIRT1262039	hsa-miR-92b	CLIP-seq
MIRT2303737	hsa-miR-98	CLIP-seq
MIRT1261931	hsa-miR-1208	CLIP-seq
MIRT2600384	hsa-miR-1256	CLIP-seq
MIRT1261933	hsa-miR-1267	CLIP-seq
MIRT2600385	hsa-miR-139-5p	CLIP-seq
MIRT1261945	hsa-miR-1915	CLIP-seq
MIRT2600387	hsa-miR-197	CLIP-seq
MIRT739557	hsa-miR-203	CLIP-seq
MIRT1261948	hsa-miR-216b	CLIP-seq
MIRT2600389	hsa-miR-30a	CLIP-seq
MIRT2600390	hsa-miR-30b	CLIP-seq
MIRT2600391	hsa-miR-30c	CLIP-seq
MIRT2600392	hsa-miR-30d	CLIP-seq
MIRT2600393	hsa-miR-30e	CLIP-seq
MIRT2303692	hsa-miR-3143	CLIP-seq
MIRT2600399	hsa-miR-3187-3p	CLIP-seq
MIRT2600400	hsa-miR-3199	CLIP-seq
MIRT1261968	hsa-miR-335	CLIP-seq
MIRT2600404	hsa-miR-34a	CLIP-seq
MIRT1261969	hsa-miR-34c-3p	CLIP-seq
MIRT2600405	hsa-miR-34c-5p	CLIP-seq
MIRT1261975	hsa-miR-3622b-5p	CLIP-seq
MIRT2600407	hsa-miR-3663-5p	CLIP-seq
MIRT2600409	hsa-miR-374c	CLIP-seq
MIRT2600411	hsa-miR-411	CLIP-seq
MIRT2600412	hsa-miR-4293	CLIP-seq
MIRT2600413	hsa-miR-4305	CLIP-seq
MIRT2600414	hsa-miR-4320	CLIP-seq
MIRT2600415	hsa-miR-4327	CLIP-seq
MIRT2600417	hsa-miR-4435	CLIP-seq
MIRT2600418	hsa-miR-4438	CLIP-seq
MIRT2600419	hsa-miR-4453	CLIP-seq
MIRT2600420	hsa-miR-4463	CLIP-seq
MIRT2600422	hsa-miR-4475	CLIP-seq
MIRT2600423	hsa-miR-4477b	CLIP-seq
MIRT2600424	hsa-miR-4494	CLIP-seq
MIRT2600425	hsa-miR-449a	CLIP-seq
MIRT2600426	hsa-miR-449b	CLIP-seq
MIRT2600427	hsa-miR-4538	CLIP-seq
MIRT2600429	hsa-miR-4650-5p	CLIP-seq
MIRT2303717	hsa-miR-4679	CLIP-seq
MIRT2600435	hsa-miR-4701-5p	CLIP-seq
MIRT2600436	hsa-miR-4708-3p	CLIP-seq
MIRT2600437	hsa-miR-4716-5p	CLIP-seq
MIRT2077196	hsa-miR-4720-5p	CLIP-seq
MIRT1262006	hsa-miR-4726-3p	CLIP-seq
MIRT1262007	hsa-miR-4738-3p	CLIP-seq
MIRT1262011	hsa-miR-4775	CLIP-seq
MIRT2600438	hsa-miR-4777-5p	CLIP-seq
MIRT2600439	hsa-miR-4781-3p	CLIP-seq
MIRT2303723	hsa-miR-4795-3p	CLIP-seq
MIRT2077197	hsa-miR-4799-3p	CLIP-seq
MIRT2600441	hsa-miR-5095	CLIP-seq
MIRT2600442	hsa-miR-5096	CLIP-seq
MIRT2600443	hsa-miR-518a-5p	CLIP-seq
MIRT2600444	hsa-miR-518d-5p	CLIP-seq
MIRT2600445	hsa-miR-519b-5p	CLIP-seq
MIRT2600446	hsa-miR-519c-5p	CLIP-seq
MIRT2600447	hsa-miR-520c-5p	CLIP-seq
MIRT2600448	hsa-miR-526a	CLIP-seq
MIRT2600449	hsa-miR-527	CLIP-seq
MIRT2600450	hsa-miR-543	CLIP-seq
MIRT1262024	hsa-miR-548c-3p	CLIP-seq
MIRT2688587	hsa-miR-548g	CLIP-seq
MIRT2303733	hsa-miR-548m	CLIP-seq
MIRT2600451	hsa-miR-548s	CLIP-seq
MIRT1262027	hsa-miR-579	CLIP-seq
MIRT2600452	hsa-miR-588	CLIP-seq
MIRT2600453	hsa-miR-590-3p	CLIP-seq
MIRT2600454	hsa-miR-618	CLIP-seq
MIRT2600455	hsa-miR-622	CLIP-seq
MIRT1262033	hsa-miR-642b	CLIP-seq
MIRT2600456	hsa-miR-655	CLIP-seq

138

Show/Hide all (138)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002181	Process	Cytoplasmic translation	IDA	8706699, 34314702
GO:0003682	Function	Chromatin binding	IEA
GO:0003682	Function	Chromatin binding	ISS
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	7959015
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	18439900, 28552616, 32029622, 34077757, 36732624, 37079666
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	ISS
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004679	Function	AMP-activated protein kinase activity	IDA	14651849, 18439900, 24563466, 36732624, 37541260
GO:0004679	Function	AMP-activated protein kinase activity	IEA
GO:0004679	Function	AMP-activated protein kinase activity	ISS
GO:0004679	Function	AMP-activated protein kinase activity	TAS
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	IDA	22797923
GO:0005515	Function	Protein binding	IPI	18439900, 19274086, 20562859, 20801214, 21072212, 21516116, 24722188, 25241761, 25416956, 28514442, 28552616, 28561066, 29892012, 30886144, 31515488, 32296183, 32707033, 32814053, 33961781, 35512704, 36931259
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9693118
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	21768291
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006646	Process	Phosphatidylethanolamine biosynthetic process	IDA	19915674
GO:0006656	Process	Phosphatidylcholine biosynthetic process	IDA	34077757
GO:0006694	Process	Steroid biosynthetic process	IEA
GO:0006695	Process	Cholesterol biosynthetic process	IEA
GO:0006914	Process	Autophagy	IEA
GO:0007165	Process	Signal transduction	TAS	7959015
GO:0008202	Process	Steroid metabolic process	IEA
GO:0008203	Process	Cholesterol metabolic process	IEA
GO:0008610	Process	Lipid biosynthetic process	IEA
GO:0008610	Process	Lipid biosynthetic process	ISS
GO:0009267	Process	Cellular response to starvation	IDA	24529379
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010494	Component	Cytoplasmic stress granule	IEA
GO:0010494	Component	Cytoplasmic stress granule	ISS
GO:0010508	Process	Positive regulation of autophagy	IBA
GO:0010508	Process	Positive regulation of autophagy	IEA
GO:0010508	Process	Positive regulation of autophagy	ISS
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	ISS
GO:0014850	Process	Response to muscle activity	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016126	Process	Sterol biosynthetic process	IEA
GO:0016239	Process	Positive regulation of macroautophagy	TAS	25126726
GO:0016241	Process	Regulation of macroautophagy	IEA
GO:0016241	Process	Regulation of macroautophagy	ISS
GO:0016301	Function	Kinase activity	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0016607	Component	Nuclear speck	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0031588	Component	Nucleotide-activated protein kinase complex	IBA
GO:0031588	Component	Nucleotide-activated protein kinase complex	IEA
GO:0031588	Component	Nucleotide-activated protein kinase complex	IPI	9693118, 25412657, 29657085
GO:0031588	Component	Nucleotide-activated protein kinase complex	ISS
GO:0031669	Process	Cellular response to nutrient levels	IDA	12747827, 29236692, 29750193, 31601708, 31601764, 36528027
GO:0031669	Process	Cellular response to nutrient levels	IDA	25412657
GO:0031669	Process	Cellular response to nutrient levels	IEA
GO:0031669	Process	Cellular response to nutrient levels	ISS
GO:0031669	Process	Cellular response to nutrient levels	NAS	9693118, 29657085
GO:0032007	Process	Negative regulation of TOR signaling	IEA
GO:0032007	Process	Negative regulation of TOR signaling	ISS
GO:0034198	Process	Cellular response to amino acid starvation	IDA	35338845
GO:0034599	Process	Cellular response to oxidative stress	IEA
GO:0034599	Process	Cellular response to oxidative stress	ISS
GO:0036064	Component	Ciliary basal body	IDA
GO:0036064	Component	Ciliary basal body	IEA
GO:0038202	Process	TORC1 signaling	IDA	12087098, 12747827, 29750193
GO:0042149	Process	Cellular response to glucose starvation	IBA
GO:0042149	Process	Cellular response to glucose starvation	IDA	18439900
GO:0042149	Process	Cellular response to glucose starvation	IDA	14651849, 18439900, 34077757, 36732624
GO:0042149	Process	Cellular response to glucose starvation	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042593	Process	Glucose homeostasis	ISS
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0043025	Component	Neuronal cell body	IEA
GO:0043025	Component	Neuronal cell body	ISS
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0045821	Process	Positive regulation of glycolytic process	ISS
GO:0045947	Process	Negative regulation of translational initiation	IDA	22578813
GO:0045948	Process	Positive regulation of translational initiation	IDA	1922062, 29750193
GO:0046872	Function	Metal ion binding	IEA
GO:0047322	Function	[hydroxymethylglutaryl-CoA reductase (NADPH)] kinase activity	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0055089	Process	Fatty acid homeostasis	ISS
GO:0055089	Process	Fatty acid homeostasis	TAS
GO:0061462	Process	Protein localization to lysosome	IDA	31601708
GO:0062028	Process	Regulation of stress granule assembly	IEA
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IEA
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	ISS
GO:0071277	Process	Cellular response to calcium ion	IEA
GO:0071277	Process	Cellular response to calcium ion	ISS
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071333	Process	Cellular response to glucose stimulus	ISS
GO:0071380	Process	Cellular response to prostaglandin E stimulus	IEA
GO:0071466	Process	Cellular response to xenobiotic stimulus	IEA
GO:0085020	Process	Protein K6-linked ubiquitination	IDA	36528027
GO:0090200	Process	Positive regulation of release of cytochrome c from mitochondria	IDA	32029622
GO:0097009	Process	Energy homeostasis	ISS
GO:0097284	Process	Hepatocyte apoptotic process	IDA	32029622
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0140823	Function	Histone H2BS36 kinase activity	IEA
GO:0140823	Function	Histone H2BS36 kinase activity	ISS
GO:1903829	Process	Positive regulation of protein localization	IEA
GO:1903829	Process	Positive regulation of protein localization	ISS
GO:1903944	Process	Negative regulation of hepatocyte apoptotic process	IDA	32029622
GO:1903944	Process	Negative regulation of hepatocyte apoptotic process	IEA
GO:1904262	Process	Negative regulation of TORC1 signaling	IBA
GO:1904262	Process	Negative regulation of TORC1 signaling	IDA	9045618, 12906785, 30651352, 35338845
GO:1904262	Process	Negative regulation of TORC1 signaling	IDA	14651849, 18439900, 36732624, 37079666
GO:1904262	Process	Negative regulation of TORC1 signaling	IEA
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	29236692, 31601708, 31601764, 36528027, 37541260
GO:1904428	Process	Negative regulation of tubulin deacetylation	IEA
GO:1904428	Process	Negative regulation of tubulin deacetylation	ISS
GO:1905691	Process	Lipid droplet disassembly	IDA	34077757
GO:1905691	Process	Lipid droplet disassembly	IEA
GO:1990044	Process	Protein localization to lipid droplet	IBA
GO:1990044	Process	Protein localization to lipid droplet	IDA	34077757
GO:1990044	Process	Protein localization to lipid droplet	IEA

MIM	HGNC	e!Ensembl
600497	9377	ENSG00000162409

P54646

Protein name

5'-AMP-activated protein kinase catalytic subunit alpha-2 (AMPK subunit alpha-2) (EC 2.7.11.1) (Acetyl-CoA carboxylase kinase) (ACACA kinase) (Hydroxymethylglutaryl-CoA reductase kinase) (HMGCR kinase) (EC 2.7.11.31)

Protein function

Catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism (PubMed:17307971, PubMed:17712357). In response to reduction of intracellular ATP levels, AM

PDB

2H6D , 2LTU , 2YZA , 3AQV , 4CFE , 4CFF , 4ZHX , 5EZV , 5ISO , 6B1U , 6B2E , 6BX6 , 7MYJ , 8BIK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	16 → 268	Protein kinase domain	Domain
PF16579	AdenylateSensor	401 → 495	Adenylate sensor of SNF1-like protein kinase	Domain

Sequence

MAEKQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLF
QQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRS
VATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKF
ECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIP
PGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVY
RAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQR
SGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFF
EMCASLITTLAR

Sequence length

552

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARTHRITIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR ACCIDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
High myopia	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRKAA2-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE MYOPIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR DYSFUNCTION, LEFT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (289)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Cerebrovascular Accidents	Stroke	CTD_human_DG	20847317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	21262957, 22021366, 24009772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	28108519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	31276230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28202516, 31376944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	31441682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenosine monophosphate deaminase deficiency	Myoadenylate deaminase deficiency	Pubtator	15766830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	28122379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	24491542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	24009772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	23396962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	28290498, 29710658, 30308492, 30324705, 30633969, 31616396, 31645006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	33942972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	30668362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	28213588	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	28951437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	28179583, 29190959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	28290498, 29710658, 30308492, 30324705, 30633969, 31616396, 31645006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	12747836	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	21459323, 27063143, 27737949, 28178661, 28365690, 29441896, 29480494, 30462530, 30507608, 30637828, 31512724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	30100905, 36661308	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	28265821, 29158183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	21459323, 27063143, 27737949, 28178661, 28365690, 29441896, 29480494, 30462530, 30507608, 30637828, 31512724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28412370		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	31400930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	27638620, 28948276, 29069736, 30053908, 31250978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26419593, 26804175, 27145268, 27779715, 28327197, 28374040, 28423712, 28656004, 28696138, 28775788, 28807345, 28856747, 29339542, 29340974, 29513571 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19723334, 24406729, 25427448, 25651975, 26752181, 26919657, 27145268, 29702405, 31507133, 31907353, 35864962, 37542585, 39512680, 40427554	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25017332	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	24792998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	27367504	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	22897928	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21418191, 22728651, 25017332, 26252753, 26986101, 28338175, 29246230, 29991055, 30311444, 31427562, 32323845, 32626741, 34638959, 34790050, 35592706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30809021	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	27638620, 28948276, 29069736, 30053908, 31250978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	20824095, 28440448, 28498463, 29249655, 29694835, 30415923, 31232177, 31515527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27705920, 35633317, 36750850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	21272562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	22897928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25491408, 28664915, 30591219, 31091257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	18594201, 31706979		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	21037199		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	Pubtator	32460327	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	21037199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	15766830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	30459625, 31199069, 31249632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Hypertrophic, Familial	Cardiomyopathy	BEFREE	14519435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30507608, 31607907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	32733639	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Core Myopathy (disorder)	Myopathy	BEFREE	29463997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	CTD_human_DG	20847317		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
cervical cancer	Cervical Cancer	BEFREE	26337566, 29400636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	26337566, 29400636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chediak-Higashi Syndrome	Chediak-Higashi Syndrome	BEFREE	30855043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	24009772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	31085159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholecystolithiasis	Pubtator	33279689, 33893772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	27090119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis Intrahepatic	Intrahepatic cholestasis	Pubtator	33893772	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	24047437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	30473753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic colitis	Colitis	BEFREE	27085036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	31531806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	31531806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleidocranial Dysplasia	Cleidocranial Dysplasia	BEFREE	29463997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28750357, 30359174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	24515110, 27314881, 28151470, 29491475, 29535833, 30636376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	27085036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24770722, 26892992, 27085036, 27996156, 29500295, 30668361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22975518, 25833196, 25854428, 26919111, 29491475, 31485623, 31648230, 31888414, 36806702, 36950803, 38149567	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29284690, 29359260, 29626503, 30519189, 30697273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20948309, 27453294, 30745848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	21536015, 29689567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic Neutropenia	BEFREE	31612075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	12427743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	23264659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystinosis	Cystinosis	BEFREE	22982317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	31729056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28225087, 29864946, 30031925, 30854676, 31704612, 31815524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12847291, 20797423, 21357378, 22412912, 24135141, 25190626, 27488451, 27611085, 28622524, 29109032, 29689567, 31292296, 31661292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	28125642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12847291, 20797423, 21357378, 22412912, 24135141, 25190626, 27488451, 27611085, 28622524, 29109032, 29689567, 31292296, 31661292, 31799531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	25595658, 35864962, 36360783, 38354757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	21931634, 31993556, 32337289, 34589546	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	31083617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16567511, 17950019, 19245656, 20222801, 21459323, 22349765, 27295301, 27427333, 27506476, 27743883, 28322508, 28573460, 28632780, 28706237, 28811612 View all (12 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	27865838, 29445083, 29778534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28322508, 30683904, 30876865, 31402399, 31442509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuralgia	Diabetic Neuralgia	BEFREE	29025860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	28632765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	23396962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	27951515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	31645006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Early infantile epileptic encephalopathy with suppression bursts	Epileptic Encephalopathy	BEFREE	29137348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26648451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	26135947, 33577023, 34170849, 37082998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	27731378, 29592879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	27731378, 29592879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	35463992	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	27938475	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fahr's disease	Fahr's disease	Pubtator	35713844	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Periodic Paralysis	Periodic Paralysis	BEFREE	25348630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	30560247		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	30560247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	25836975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	21459323, 23823021, 28344322, 28452943, 29092796, 30733434, 31608624, 31697646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	31108350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30007970, 30522100, 31742890		★★★★★ ★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	30560247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallstones	Gallstones	Pubtator	33279689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gardner Syndrome	Gardner Syndrome	BEFREE	29050587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gilbert Disease	Gilbert syndrome	Pubtator	27444220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gilbert Disease (disorder)	Gilbert Disease	BEFREE	27444220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	16518831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	20880848, 24607408, 38098117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28440504, 30678307, 30909789, 31679687, 31810928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28440504, 30678307, 30909789, 31679687, 31810928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	16518831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27001465, 28776671, 31488033, 31542479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27532105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease	Glycogen storage disease	Pubtator	32259713	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	36555150	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gyrate Atrophy	Gyrate Atrophy	BEFREE	23076989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	33274210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	29069788, 29480501, 31759100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	32460327	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29284690, 29359260, 29626503, 30519189, 30697273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	32259713, 32460327	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	21572254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	25846811	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	25049200	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
HERMANSKY-PUDLAK SYNDROME 5	Hermansky-Pudlak Syndrome	BEFREE	30977277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	28632780, 29509900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	20222801, 28356082, 28743390, 29221790, 29941677, 30811418, 31205529, 31529536, 31581839, 31706979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	36806702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	30325018, 30811418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	26908215, 27762456, 31120956, 31226525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	36297114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	32914566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28213467, 28436023, 29659128, 30664704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	31736784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	31488323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	31736784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18359290, 35523819	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30511343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29967351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28285145, 30219731, 30848530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	26114600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	15371448, 26001396, 28183786, 33509040	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	22323564	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	BEFREE	29444469, 30876865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	25049200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28860665, 31661633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	31531806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	36246395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lafora Disease	Lafora disease	Pubtator	21728993	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	31147451		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	21262957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	25846811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36148953	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	20668229, 26505133, 27864418, 28118076, 30082823, 30134922, 31325181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	31336728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	16984726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21274505, 25131770, 25326336, 26089158, 26419593, 26707164, 26894973, 27602492, 27644987, 28676953, 29152112, 29449537, 29627320, 30009356, 30311444 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	29449537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	23510538	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	28689811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	28689811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	26089158, 29627320, 30717766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21258249, 25798539, 30157903, 32198390, 36281945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	30415923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	36872368	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	29755474	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	36815949	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	29755474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	30388519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26419593, 26804175, 27145268, 27779715, 28327197, 28374040, 28423712, 28656004, 28696138, 28775788, 28807345, 28856747, 29339542, 29340974, 29513571 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26648451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	27731378, 29592879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29234282, 30923462, 31799198, 31840883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20824095, 28440448, 28498463, 29249655, 29694835, 30415923, 31232177, 31515527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	31336728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25491408, 30591219, 31091257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	17651733, 21357378, 25493642, 30355942, 30356139, 30997723, 31088566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21572254, 26359363, 26499184, 26734992, 29156794, 29228678, 29572236, 30041429, 30453068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24681952, 25756516, 29635244, 30054562, 30405404, 30896863, 31330497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	29546654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	27638620, 28948276, 29069736, 30053908, 31250978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18466113, 20222801, 21245141, 21572254, 22021366, 23291663, 23370395, 24770722, 24829520, 24994714, 25871473, 26337566, 26359363, 26707164, 26934201 View all (39 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	26337566, 29400636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21393859, 24515110, 27314881, 28151470, 29491475, 29535833, 30636376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19717424, 29532562		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19187764, 19249673, 22588166, 29027991, 29655680, 30651927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25846811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	25190626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Bone Disorder	Metabolic Bone Disorder	BEFREE	30013450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	12847291, 21459323, 22016761, 22869320, 28622524, 29064586, 29738801, 29942003, 30104247, 30277819, 30968342, 31071567, 31144451, 31292296, 31817196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	23510538, 29394526, 29480475	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	37904219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	19245656, 20222801, 25779083, 27048379, 31164725, 31241065, 31292296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	23536703, 31480724, 33066427	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse Syndrome	Mitral Valve Prolapse	BEFREE	30841577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	30419344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Emery Dreifuss	Emery dreifuss muscular dystrophy	Pubtator	23258787	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	30463013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Oculopharyngeal	Oculopharyngeal Muscular Dystrophy	BEFREE	18397876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	31682805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	21037199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	25936391, 29325933, 30697273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	21536015, 29689567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	28067669		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	29982462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	34653793	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	25872765	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30557400, 30700698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18466113, 18594201, 20222801, 21911917, 23274086, 23291663, 23921130, 24236567, 24515110, 24694946, 25629604, 26001218, 26359363, 26717043, 27145268 View all (26 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrogenic Diabetes Insipidus, Type I	Nephrogenic Diabetes Insipidus	BEFREE	27534996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24269733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	33036367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28811634, 30277819, 30853597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	27762456, 28566408, 29327584, 29713145, 29964102, 30060948, 30235452, 30291215, 30544824, 30675881, 31115630, 31195981, 31239155, 31421115, 31445019 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25629933, 28538732, 29990847, 30415923, 31232177, 31293647, 31562701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	12847291, 20444420, 24484739, 25123125, 25479240, 25626736, 25779083, 26035386, 26368128, 26817629, 27128935, 28264489, 28445161, 28622524, 28811612 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	22323564, 27481183	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	22990076, 27444220, 32152146, 36806702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Opitz GBBB Syndrome, X-Linked	Opitz GBBB Syndrome, X-Linked	BEFREE	29137348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	30516280, 30537740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28810524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30013450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	30013450	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28063979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	22897928	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25491408, 30591219, 31091257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22897928, 25491408, 26261517, 29620187, 32312965, 36114703, 36308626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	29635803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21357378, 25493642, 30355942, 30356139, 30997723, 31088566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	23159620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30323244, 30365057, 31904416, 32345326, 33650657, 36284209	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29151954, 30575918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28840510, 29100525, 30112966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	29115479	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
periodic paralysis (finding)	Periodic Paralysis	BEFREE	25348630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peutz-Jeghers Syndrome	Peutz-Jeghers Syndrome	BEFREE	29907081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	BEFREE	30860580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	29675630, 31816397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	19574280, 29958542, 31722718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	26373822	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	21262957, 22021366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	21968881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progeria	Progeria	BEFREE	26115946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26359363, 26499184, 26734992, 29156794, 29228678, 29572236, 30041429, 30453068, 31395901, 31597941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26447757, 27248322, 28876465, 29577356, 32931739, 34309216	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30511343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	23258787	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28364627, 30890932, 31049028, 31302203, 31611754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20948309, 27453294, 30745848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28273365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	30290168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	29620138, 34205996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	29947538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	27939519, 28647359, 28883754, 28974562, 29866515, 30223098, 30797785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	31322006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	30015975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23029387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24769813, 33526991, 36505439	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	31191828, 31620247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	21459323, 23823021, 23948064, 24486702, 25957914, 28344322, 28452943, 28821440, 29092796, 29126901, 29158183, 30733434, 30972177, 31608624, 31697646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24681952, 25756516, 29635244, 30054562, 30405404, 30896863, 31330497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25756516, 26919111, 28052040, 28423719, 30015846, 30720062, 32227453, 33538080, 35075806	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28825325, 30067508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	30718913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	30219731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	28243204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	26617795, 30575918, 32964981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	29147952, 29546654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	29546654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27145268, 29094413, 30152053, 30791936, 31004703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27145268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	20668229, 24599401, 28561066		★★★★★ ★☆☆☆☆ Found in Text Mining only
TUBEROUS SCLEROSIS 1 (disorder)	Tuberous Sclerosis	BEFREE	24599401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tyrosine Kinase 2 Deficiency	Tyrosine kinase 2 deficiency	Pubtator	34635505	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	26337566, 28230778, 33236135, 36658117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	24781943, 37647867	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	30205395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	28919424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	29597876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Wolff-Parkinson-White Syndrome	Wolff-Parkinson-White Syndrome	BEFREE	14519435		★★★★★ ★☆☆☆☆ Found in Text Mining only

PRKAA2 (protein kinase AMP-activated catalytic subunit alpha 2)