PRKAG2 (protein kinase AMP-activated non-catalytic subunit gamma 2)

Gene

• Entrez ID: 51422
• Gene name: Protein kinase AMP-activated non-catalytic subunit gamma 2
• Gene symbol: PRKAG2
• Synonyms (NCBI Gene): AAKG, AAKG2, CMH6, H91620p, WPWS
• Chromosome: 7
• Chromosome location: 7q36.1
• Summary: AMP-activated protein kinase (AMPK) is a heterotrimeric protein composed of a catalytic alpha subunit, a noncatalytic beta subunit, and a noncatalytic regulatory gamma subunit. Various forms of each of these subunits exist, encoded by different genes. AMP

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs28938173	G>T	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs61746358	G>A,T	Uncertain-significance, conflicting-interpretations-of-pathogenicity, likely-benign	Genic upstream transcript variant, 5 prime UTR variant, missense variant, synonymous variant, coding sequence variant
rs116541276	T>C	Likely-benign, benign, conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs121908987	C>A,G,T	Uncertain-significance, pathogenic	Missense variant, coding sequence variant
rs121908988	T>C	Uncertain-significance, pathogenic	Missense variant, coding sequence variant
rs121908989	T>A,C	Pathogenic	Missense variant, coding sequence variant
rs121908990	G>A,C	Pathogenic	Missense variant, coding sequence variant
rs121908991	C>A,T	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs139579816	A>C	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant, genic upstream transcript variant, 5 prime UTR variant
rs144857453	C>A,T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Genic upstream transcript variant, 5 prime UTR variant, coding sequence variant, missense variant
rs193922697	G>A,T	Likely-pathogenic, pathogenic	Synonymous variant, missense variant, coding sequence variant
rs201240745	G>C	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Intron variant, 5 prime UTR variant, missense variant, coding sequence variant, genic upstream transcript variant, upstream transcript variant
rs201878539	G>A	Conflicting-interpretations-of-pathogenicity, likely-benign	Missense variant, coding sequence variant
rs201953758	C>T	Conflicting-interpretations-of-pathogenicity, likely-benign	5 prime UTR variant, missense variant, coding sequence variant, genic upstream transcript variant
rs267606976	A>G	Likely-pathogenic, pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs267606977	T>C	Pathogenic	Missense variant, coding sequence variant
rs267606978	C>G	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs267606979	A>G	Pathogenic	Missense variant, coding sequence variant
rs376173303	T>C	Conflicting-interpretations-of-pathogenicity, likely-benign	Intron variant
rs397517278	G>T	Conflicting-interpretations-of-pathogenicity	5 prime UTR variant, upstream transcript variant, genic upstream transcript variant, intron variant
rs397517283	A>C,T	Likely-pathogenic	Missense variant, coding sequence variant
rs587776643	->TAA	Pathogenic	Coding sequence variant, inframe insertion
rs727504392	G>A	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs730880982	T>G	Likely-pathogenic	Coding sequence variant, missense variant
rs730882148	C>G	Pathogenic	Coding sequence variant, missense variant
rs1131692281	C>G,T	Pathogenic	Genic upstream transcript variant, 5 prime UTR variant, coding sequence variant, missense variant
rs1563161306	A>G	Likely-pathogenic	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1262410	hsa-miR-132	CLIP-seq
MIRT1262411	hsa-miR-1324	CLIP-seq
MIRT1262412	hsa-miR-155	CLIP-seq
MIRT1262413	hsa-miR-205	CLIP-seq
MIRT1262414	hsa-miR-212	CLIP-seq
MIRT1262415	hsa-miR-3121-3p	CLIP-seq
MIRT1262416	hsa-miR-3140-5p	CLIP-seq
MIRT1262417	hsa-miR-3614-5p	CLIP-seq
MIRT1262418	hsa-miR-4258	CLIP-seq
MIRT1262419	hsa-miR-4293	CLIP-seq
MIRT1262420	hsa-miR-4766-5p	CLIP-seq
MIRT1262421	hsa-miR-500a	CLIP-seq
MIRT1262422	hsa-miR-548al	CLIP-seq
MIRT1262423	hsa-miR-570	CLIP-seq
MIRT1262424	hsa-miR-1183	CLIP-seq
MIRT1262425	hsa-miR-1305	CLIP-seq
MIRT1262426	hsa-miR-181a	CLIP-seq
MIRT1262427	hsa-miR-181b	CLIP-seq
MIRT1262428	hsa-miR-181c	CLIP-seq
MIRT1262429	hsa-miR-181d	CLIP-seq
MIRT1262430	hsa-miR-200b	CLIP-seq
MIRT1262431	hsa-miR-200c	CLIP-seq
MIRT1262432	hsa-miR-2053	CLIP-seq
MIRT1262433	hsa-miR-320a	CLIP-seq
MIRT1262434	hsa-miR-320b	CLIP-seq
MIRT1262435	hsa-miR-320c	CLIP-seq
MIRT1262436	hsa-miR-320d	CLIP-seq
MIRT1262437	hsa-miR-3613-5p	CLIP-seq
MIRT1262438	hsa-miR-3692	CLIP-seq
MIRT1262439	hsa-miR-423-3p	CLIP-seq
MIRT1262440	hsa-miR-425	CLIP-seq
MIRT1262441	hsa-miR-4262	CLIP-seq
MIRT1262442	hsa-miR-429	CLIP-seq
MIRT1262443	hsa-miR-4422	CLIP-seq
MIRT1262444	hsa-miR-4429	CLIP-seq
MIRT1262445	hsa-miR-4661-3p	CLIP-seq
MIRT1262446	hsa-miR-4775	CLIP-seq
MIRT1262447	hsa-miR-498	CLIP-seq
MIRT1262448	hsa-miR-548u	CLIP-seq
MIRT1262449	hsa-miR-590-3p	CLIP-seq
MIRT1262450	hsa-miR-617	CLIP-seq
MIRT1262451	hsa-miR-7	CLIP-seq
MIRT1262426	hsa-miR-181a	CLIP-seq
MIRT1262427	hsa-miR-181b	CLIP-seq
MIRT1262428	hsa-miR-181c	CLIP-seq
MIRT1262429	hsa-miR-181d	CLIP-seq
MIRT1262416	hsa-miR-3140-5p	CLIP-seq
MIRT2077365	hsa-miR-3163	CLIP-seq
MIRT1262441	hsa-miR-4262	CLIP-seq
MIRT2077366	hsa-miR-4668-3p	CLIP-seq
MIRT1262447	hsa-miR-498	CLIP-seq
MIRT2077367	hsa-miR-499-3p	CLIP-seq
MIRT2077368	hsa-miR-499a-3p	CLIP-seq
MIRT2303862	hsa-miR-1301	CLIP-seq
MIRT1262426	hsa-miR-181a	CLIP-seq
MIRT1262427	hsa-miR-181b	CLIP-seq
MIRT1262428	hsa-miR-181c	CLIP-seq
MIRT1262429	hsa-miR-181d	CLIP-seq
MIRT1262441	hsa-miR-4262	CLIP-seq
MIRT2303863	hsa-miR-4676-5p	CLIP-seq
MIRT2077367	hsa-miR-499-3p	CLIP-seq
MIRT2077368	hsa-miR-499a-3p	CLIP-seq
MIRT2303864	hsa-miR-5047	CLIP-seq
MIRT2303865	hsa-miR-575	CLIP-seq
MIRT2303866	hsa-miR-323-3p	CLIP-seq
MIRT2303867	hsa-miR-4496	CLIP-seq
MIRT2392977	hsa-miR-214	CLIP-seq
MIRT1262417	hsa-miR-3614-5p	CLIP-seq
MIRT2392978	hsa-miR-3619-5p	CLIP-seq
MIRT1262418	hsa-miR-4258	CLIP-seq
MIRT2392979	hsa-miR-4274	CLIP-seq
MIRT2392980	hsa-miR-4291	CLIP-seq
MIRT2392981	hsa-miR-4462	CLIP-seq
MIRT2392982	hsa-miR-4711-5p	CLIP-seq
MIRT2392983	hsa-miR-495	CLIP-seq
MIRT1262422	hsa-miR-548al	CLIP-seq
MIRT2392984	hsa-miR-761	CLIP-seq
MIRT2392985	hsa-miR-922	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004679	Function	AMP-activated protein kinase activity	IEA
GO:0004862	Function	CAMP-dependent protein kinase inhibitor activity	IDA	17255938
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005524	Function	ATP binding	IDA	15877279
GO:0005524	Function	ATP binding	IEA
GO:0005615	Component	Extracellular space	HDA	22664934
GO:0005634	Component	Nucleus	IBA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005977	Process	Glycogen metabolic process	IMP	11827995, 15877279
GO:0006110	Process	Regulation of glycolytic process	IBA
GO:0006110	Process	Regulation of glycolytic process	IMP	15877279
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006754	Process	ATP biosynthetic process	TAS	11371514
GO:0008603	Function	CAMP-dependent protein kinase regulator activity	IMP	15877279
GO:0008607	Function	Phosphorylase kinase regulator activity	IMP	15877279
GO:0016126	Process	Sterol biosynthetic process	TAS	9208914
GO:0016208	Function	AMP binding	IBA
GO:0016208	Function	AMP binding	IEA
GO:0016208	Function	AMP binding	TAS
GO:0019217	Process	Regulation of fatty acid metabolic process	IMP	15877279
GO:0019887	Function	Protein kinase regulator activity	IBA
GO:0019887	Function	Protein kinase regulator activity	IDA	24563466
GO:0019887	Function	Protein kinase regulator activity	IEA
GO:0019901	Function	Protein kinase binding	IBA
GO:0019901	Function	Protein kinase binding	IDA	10698692
GO:0019901	Function	Protein kinase binding	IEA
GO:0030295	Function	Protein kinase activator activity	IMP	15877279
GO:0031588	Component	Nucleotide-activated protein kinase complex	IBA
GO:0031588	Component	Nucleotide-activated protein kinase complex	IDA	15877279
GO:0031588	Component	Nucleotide-activated protein kinase complex	IEA
GO:0031588	Component	Nucleotide-activated protein kinase complex	ISS
GO:0031669	Process	Cellular response to nutrient levels	ISS
GO:0035556	Process	Intracellular signal transduction	IMP	15877279
GO:0042149	Process	Cellular response to glucose starvation	IBA
GO:0043531	Function	ADP binding	IDA	15877279
GO:0043609	Process	Regulation of carbon utilization	IBA
GO:0045722	Process	Positive regulation of gluconeogenesis	IBA
GO:0046320	Process	Regulation of fatty acid oxidation	TAS	9208914
GO:0046324	Process	Regulation of D-glucose import	TAS	11827995
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	TAS

Other IDs

• MIM: 602743
• HGNC: 9386
• e!Ensembl: ENSG00000106617

Protein

• UniProt ID: Q9UGJ0
• Protein name: 5'-AMP-activated protein kinase subunit gamma-2 (AMPK gamma2) (AMPK subunit gamma-2) (H91620p)
• Protein function: AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism (PubMed:14722619, PubMed:24563466). In response to reduction of intracellular ATP leve
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00571	CBS	355 → 410	CBS domain	Domain
  PF00571	CBS	429 → 484	CBS domain	Domain
  PF00571	CBS	502 → 556	CBS domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Isoform B is ubiquitously expressed except in liver and thymus. The highest level is detected in heart with abundant expression in placenta and testis.
• Sequence:

  MGSAVMDTKKKKDVSSPGGSGGKKNASQKRRSLRVHIPDLSSFAMPLLDGDLEGSGKHSS
  RKVDSPFGPGSPSKGFFSRGPQPRPSSPMSAPVRPKTSPGSPKTVFPFSYQESPPRSPRR
  MSFSGIFRSSSKESSPNSNPATSPGGIRFFSRSRKTSGLSSSPSTPTQVTKQHTFPLESY
  KHEPERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAAALGPAEA
  GMLEKLEFEDEAVEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANG
  VRAAPLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKP
  LVNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAF
  MKQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVIN
  LAAEKTYNNLDITVTQALQHRSQYFEGVVKCNKLEILETIVDRIVRAEVHRLVVVNEADS
  IVGIISLSDILQALILTPAGAKQKETETE

• Sequence length: 569

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Cardiomyopathy	Pathogenic; Likely pathogenic	rs121908987, rs193922697	RCV000769245 RCV000030377	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cardiovascular phenotype	Pathogenic; Likely pathogenic	rs121908987, rs121908990, rs267606977	RCV000621452 RCV002399312 RCV002399313 RCV002369682	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Familial Hypertrophic Cardiomyopathy with Wolff-Parkinson-White Syndrome	Pathogenic	rs121908987	RCV002222346	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Gastric cancer	Pathogenic	rs121908991	RCV005887336	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hypertrophic cardiomyopathy	Likely pathogenic; Pathogenic	rs727504392, rs121908987, rs28938173, rs121908991, rs267606977, rs267606978, rs193922697, rs397517283, rs1563161306	RCV000154556 RCV000768489 RCV000211739 RCV000038920 RCV000852579 RCV000211740 RCV000497723 RCV000038962 RCV000768490	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Hypertrophic cardiomyopathy 6	Pathogenic; Likely pathogenic	rs121908987, rs587776643, rs28938173, rs121908989, rs267606977, rs267606978	RCV000007249 RCV000007251 RCV000007252 RCV000007253 RCV000007257 RCV000007258	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Lethal congenital glycogen storage disease of heart	Pathogenic; Likely pathogenic	rs2151024166, rs730882148, rs2536276180, rs267606979, rs121908987, rs121908991, rs267606977, rs878855017, rs267606978, rs193922697, rs1563131309, rs1804721948, rs121908990, rs1808950153	RCV002007521 RCV000162026 RCV003037274 RCV002898663 RCV000458247 RCV000007255 RCV000813711 RCV000230623 RCV003508844 RCV001231512 RCV000641187 RCV000687370 RCV001061341 RCV001221470 RCV001213304	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Primary familial hypertrophic cardiomyopathy	Pathogenic	rs121908987	RCV000211845	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
PRKAG2-related disorder	Likely pathogenic	rs28938173	RCV004528089	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Wolff-Parkinson-White pattern	Pathogenic	rs121908987	RCV000007248	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Wolff-Parkinson-White syndrome, childhood-onset	Pathogenic	rs121908990	RCV000007254	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOMALOUS ATRIOVENTRICULAR EXCITATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arrhythmogenic right ventricular dysplasia 9	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARRHYTHMOGENIC RIGHT VENTRICULAR DYSPLASIA, FAMILIAL, 9	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILE DUCT DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLADDER CALCULUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, FAMILIAL HYPERTROPHIC, 1	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, FAMILIAL HYPERTROPHIC, 6	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, HYPERTROPHIC, FAMILIAL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR ACCIDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CORONARY ARTERY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFERENTIATED THYROID CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLYCOGEN STORAGE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLYCOGEN STORAGE DISEASE OF HEART, LETHAL CONGENITAL	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE HEART DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE NEPHROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic cardiomyopathy 1	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Left ventricular hypertrophy	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT EPITHELIAL TUMOR OF OVARY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROLITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary dilated cardiomyopathy	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRKAG2 cardiac syndrome	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRKAG2-related cardiomyopathy	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROLIFERATIVE DIABETIC RETINOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal cysts and diabetes syndrome	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UROLITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WOLFF-PARKINSON-WHITE SYNDROME	—	CTD, Disgenet, GenCC, HPO CTD, Disgenet, GenCC, HPO CTD, Disgenet, GenCC, HPO CTD, Disgenet, GenCC, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	32039845	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia	Anemia	BEFREE	29411465		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anorexia Nervosa	Anorexia nervosa	Pubtator	35703085	Associate	★☆☆☆☆ Found in Text Mining only
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	11407343, 32646569	Associate	★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	BEFREE	19632136		★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	GWASDB_DG	23263486		★☆☆☆☆ Found in Text Mining only
Asymmetric Septal Hypertrophy	Septal Hypertrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	11748095		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	LHGDN	11748095		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	32646569, 37203300	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Atrioventricular Block	Atrioventricular block	BEFREE	11827995, 28917552		★☆☆☆☆ Found in Text Mining only
Atrioventricular Block	Atrioventricular block	Pubtator	11827995	Associate	★☆☆☆☆ Found in Text Mining only
Atrioventricular Block	Atrioventricular block	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	31838722	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	31838722		★☆☆☆☆ Found in Text Mining only
Biventricular hypertrophy	Biventricular hypertrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Bradycardia	Bradycardia	Pubtator	23741347, 35509080	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23034890		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23034890	Associate	★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	Pubtator	33922358	Associate	★☆☆☆☆ Found in Text Mining only
Cardiac Conduction System Disease	Cardiac conduction disease	Pubtator	28690312	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	11827995, 16716659, 23778007, 28546535, 28550180	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	12782567, 14519435, 16275868, 19632136, 20600102, 26496977, 27082122, 28009297, 28546535, 29452156, 29480501		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	LHGDN	15673802, 18158359		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	CLINVAR_DG	15673802, 23992123		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	Pubtator	28546535, 32150461, 32233023, 32646569, 35544052, 37932845	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	GENOMICS_ENGLAND_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	37932845	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	15673802, 15766830, 15877279, 16716659, 23741347, 28498465, 28550180, 28771489, 28797094, 29298659, 30775854, 31347270, 32150461, 35413566, 37466024	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic Familial	Cardiomyopathy	Pubtator	16716659, 18403758, 28498465, 28690312	Associate	★☆☆☆☆ Found in Text Mining only
CARDIOMYOPATHY, FAMILIAL HYPERTROPHIC, 6 (disorder)	Cardiomyopathy	UNIPROT_DG	11371514, 11827995		★☆☆☆☆ Found in Text Mining only
CARDIOMYOPATHY, FAMILIAL HYPERTROPHIC, 6 (disorder)	Cardiomyopathy	CLINVAR_DG	11407343, 11827995, 14722619, 15611370, 28917552		★☆☆☆☆ Found in Text Mining only
CARDIOMYOPATHY, FAMILIAL HYPERTROPHIC, 6 (disorder)	Cardiomyopathy	GENOMICS_ENGLAND_DG	15673802, 194200, 27604308		★☆☆☆☆ Found in Text Mining only
CARDIOMYOPATHY, FAMILIAL HYPERTROPHIC, 6 (disorder)	Cardiomyopathy	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Hypertrophic, Familial	Cardiomyopathy	BEFREE	11371514, 14519435		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Hypertrophic, Familial	Cardiomyopathy	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	20022652, 30689184		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	30813608	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30689184		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Kidney Diseases	Kidney Disease	GWASDB_DG	20383146, 22479191		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	24253112, 30559760		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30248490		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20622004		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	20622004		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20622004	Associate	★☆☆☆☆ Found in Text Mining only
Conduct Disorder	Conduct disorder	Pubtator	23741347, 23778007	Associate	★☆☆☆☆ Found in Text Mining only
Conduction disorder of the heart	Conduction Disorder Of The Heart	BEFREE	17483151, 23741347, 29452156		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	31345272		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	23741347		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Congestive heart failure	Congestive Heart Failure	HPO_DG			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Dermatitis, Atopic	Dermatitis	GWASDB_DG	21666691		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	20682687		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	GWASCAT_DG	29703844, 31451708		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	20682687		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	20682687, 28690312	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	GWASCAT_DG	29703844, 31451708		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	20022652		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	29703844		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	29703844	Associate	★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	15673802		★☆☆☆☆ Found in Text Mining only
Fatal congenital hypertrophic cardiomyopathy due to glycogen storage disease	Fatal Congenital Hypertrophic Cardiomyopathy	Orphanet			★☆☆☆☆ Found in Text Mining only
Generalized glycogen storage disease of infants	Glycogen Storage Disease	BEFREE	15673802, 27692944, 28801758		★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	GWASCAT_DG	29891935		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease	Glycogen Storage Disease	LHGDN	12015471, 16487706, 17431505		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glycogen Storage Disease	Glycogen Storage Disease	BEFREE	12546691, 16487706, 27692944, 28431061		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glycogen Storage Disease of Heart, Lethal Congenital	Glycogen Storage Disease	CLINVAR_DG	11748095, 14722619, 15611370, 15877279, 16836667, 18403758, 20031621, 23992123, 25611685, 25997934, 26085771, 27573176, 27621313		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glycogen Storage Disease of Heart, Lethal Congenital	Glycogen Storage Disease	GENOMICS_ENGLAND_DG	15673802, 194200, 27604308		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glycogen Storage Disease of Heart, Lethal Congenital	Glycogen Storage Disease	ORPHANET_DG	15877279, 17667862		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glycogen Storage Disease of Heart, Lethal Congenital	Glycogen Storage Disease	UNIPROT_DG	15877279		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glycogen Storage Disease of Heart, Lethal Congenital	Glycogen Storage Disease	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	15673802, 27692944, 28801758		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	27692944	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IIb	Glycogen Storage Disease	BEFREE	12782567, 18158359, 20005292, 20031621, 20600102		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IIb	Glycogen storage disease	Pubtator	15673802	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen storage disease, type IX	Glycogen Storage Disease	BEFREE	17667862		★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASDB_DG	23263486		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Block	Heart Block	BEFREE	28431061		★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	15877279	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	11827995, 15766830, 27692944, 28550180, 31347270, 37932845	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	27573176		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	23741347		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	23741347, 32646569, 37932845	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemorrhage	Hemorrhage	Pubtator	37203300	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30689184		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	CLINGEN_DG	11112354, 11371514, 11827995, 12782567, 15611370, 15673802, 16339829, 16487706, 18403758, 19787389, 20005292, 23741347, 27532257, 28009297, 7657794		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	11318603, 11827995, 12716108, 15673802, 15766830, 15877279, 16487706, 16716659, 17667862, 18409188, 18812404, 19632136, 19787389, 23741347, 26496977, 28431061, 28917552, 31347270		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	CLINVAR_DG	11407343, 11827995, 14519435, 14722619, 15611370, 15877279, 16487706, 16716659, 16836667, 17483151, 17597581, 17711718, 19787389, 19808419, 20005292, 20031621, 20600102, 23778007, 23829931, 25092788, 25611685, 26729852, 27532257		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	LHGDN	15673802, 16487706		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	HPO_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	11318603, 11827995, 12716108, 15673802, 15877279, 16487706, 16716659, 17667862, 18812404, 19787389, 23741347, 26496977, 31347270		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	11827995, 23741347, 26496977, 28550180, 29298659	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	15673802, 15766830, 23741347, 35509080	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy Right Ventricular	Right ventricular hypertrophy	Pubtator	16716659	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37932845	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	21813245		★☆☆☆☆ Found in Text Mining only
Insulin-resistant diabetes mellitus	Insulin-resistant diabetes mellitus	BEFREE	12546691		★☆☆☆☆ Found in Text Mining only
Ischemic Attack Transient	Transient ischemic attack	Pubtator	28690312	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	20728256		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	GWASCAT_DG	20383146, 26831199, 31152163		★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning disorders	Pubtator	28690312	Associate	★☆☆☆☆ Found in Text Mining only
Left Bundle-Branch Block	Left Bundle-Branch Block	HPO_DG			★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	15673802, 23741347, 29480501		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Liver carcinoma	Liver carcinoma	BEFREE	23457527		★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long qt syndrome	Pubtator	34582124	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23034890		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30997723		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20622004		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20622004		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	11827995	Associate	★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular angina	Pubtator	23741347, 23778007, 28690312, 29298659	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	37932845	Associate	★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	LHGDN	15766830		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neonatal hypoglycemia	Hypoglycemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	20728256		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON RARE IN EUROPE: Familial isolated hypertrophic cardiomyopathy	Hypertrophic Cardiomyopathy	Orphanet			★☆☆☆☆ Found in Text Mining only
NON RARE IN EUROPE: Wolff-Parkinson-White syndrome	Wolff-Parkinson-White syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29107296		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29107296, 33922358, 39174891	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30997723		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30997723	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30997723	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Paroxysmal supraventricular tachycardia	Paroxysmal supraventricular tachycardia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Preexcitation Syndrome	Wolff-Parkinson-White Syndrome	BEFREE	11748095, 12015471, 16836667, 19808419, 23741347		★☆☆☆☆ Found in Text Mining only
Preexcitation Syndrome	Wolff-Parkinson-White Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	GWASCAT_DG	30487263		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	30248490	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	20622004		★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	BEFREE	20622004		★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	16716659		★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	26496977	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular Fibrillation	BEFREE	31720784		★☆☆☆☆ Found in Text Mining only
Ventricular hypertrophy	Ventricular hypertrophy	BEFREE	12782567, 28009297, 28801758, 31720784		★☆☆☆☆ Found in Text Mining only
Ventricular preexcitation	Ventricular preexcitation	BEFREE	11748095, 11827995, 12015471, 12782567, 16716659, 16836667, 19808419, 23741347, 28009297, 28431061, 28546535		★☆☆☆☆ Found in Text Mining only
Ventricular preexcitation	Ventricular preexcitation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Wolff-Parkinson-White Syndrome	Wolff-Parkinson-White Syndrome	BEFREE	11371514, 11748095, 12716108, 12782567, 14519435, 15877279, 16686673, 16836667, 18812404, 20031621, 20381067, 23992123, 27573176		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Wolff-Parkinson-White Syndrome	Wolff-Parkinson-White Syndrome	UNIPROT_DG	11407343, 11748095, 14722619		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Wolff-Parkinson-White Syndrome	Wolff-Parkinson-White Syndrome	LHGDN	12716108		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Wolff-Parkinson-White Syndrome	Wolff-Parkinson-White Syndrome	GENOMICS_ENGLAND_DG	15673802, 194200, 27604308		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Wolff-Parkinson-White Syndrome	Wolff-Parkinson-White Syndrome	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Wolff-Parkinson-White Syndrome	Wolff-Parkinson-White Syndrome	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Wolff-Parkinson-White Syndrome	Wolff-Parkinson-White Syndrome	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations