Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	5516
Gene name	Protein phosphatase 2 catalytic subunit beta
Gene symbol	PPP2CB
Synonyms (NCBI Gene)	PP2AbetaPP2CB
Chromosome	8
Chromosome location	8p12
Summary	This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which

251 Show/Hide all (251)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016657	hsa-miR-425-5p	Sequencing	20371350
MIRT039452	hsa-miR-421	CLASH	23622248
MIRT438391	hsa-miR-183-5p	Luciferase reporter assayWestern blotqRT-PCR	25152390
MIRT438391	hsa-miR-183-5p	Luciferase reporter assayWestern blotqRT-PCR	25152390
MIRT555324	hsa-miR-150-5p	PAR-CLIP	21572407
MIRT016657	hsa-miR-425-5p	PAR-CLIP	21572407
MIRT555323	hsa-miR-548b-3p	PAR-CLIP	21572407
MIRT555322	hsa-miR-216b-5p	PAR-CLIP	21572407
MIRT555320	hsa-miR-6814-5p	PAR-CLIP	21572407
MIRT555321	hsa-miR-130b-5p	PAR-CLIP	21572407
MIRT555319	hsa-miR-302b-5p	PAR-CLIP	21572407
MIRT555318	hsa-miR-302d-5p	PAR-CLIP	21572407
MIRT555317	hsa-miR-549a	PAR-CLIP	21572407
MIRT555316	hsa-miR-4753-3p	PAR-CLIP	21572407
MIRT439916	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439916	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT555324	hsa-miR-150-5p	PAR-CLIP	21572407
MIRT016657	hsa-miR-425-5p	PAR-CLIP	21572407
MIRT555323	hsa-miR-548b-3p	PAR-CLIP	21572407
MIRT555322	hsa-miR-216b-5p	PAR-CLIP	21572407
MIRT555320	hsa-miR-6814-5p	PAR-CLIP	21572407
MIRT555321	hsa-miR-130b-5p	PAR-CLIP	21572407
MIRT555319	hsa-miR-302b-5p	PAR-CLIP	21572407
MIRT555318	hsa-miR-302d-5p	PAR-CLIP	21572407
MIRT555317	hsa-miR-549a	PAR-CLIP	21572407
MIRT555316	hsa-miR-4753-3p	PAR-CLIP	21572407
MIRT1257248	hsa-miR-1265	CLIP-seq
MIRT1257249	hsa-miR-1273g	CLIP-seq
MIRT1257250	hsa-miR-133a	CLIP-seq
MIRT1257251	hsa-miR-133b	CLIP-seq
MIRT1257252	hsa-miR-143	CLIP-seq
MIRT1257253	hsa-miR-150	CLIP-seq
MIRT1257254	hsa-miR-155	CLIP-seq
MIRT1257255	hsa-miR-183	CLIP-seq
MIRT1257256	hsa-miR-1911	CLIP-seq
MIRT1257257	hsa-miR-192	CLIP-seq
MIRT1257258	hsa-miR-215	CLIP-seq
MIRT1257259	hsa-miR-216b	CLIP-seq
MIRT1257260	hsa-miR-2392	CLIP-seq
MIRT1257261	hsa-miR-299-5p	CLIP-seq
MIRT1257262	hsa-miR-3129-3p	CLIP-seq
MIRT1257263	hsa-miR-3163	CLIP-seq
MIRT1257264	hsa-miR-3179	CLIP-seq
MIRT1257265	hsa-miR-3646	CLIP-seq
MIRT1257266	hsa-miR-365	CLIP-seq
MIRT1257267	hsa-miR-3692	CLIP-seq
MIRT1257268	hsa-miR-3714	CLIP-seq
MIRT1257269	hsa-miR-371-5p	CLIP-seq
MIRT1257270	hsa-miR-371b-5p	CLIP-seq
MIRT1257271	hsa-miR-425	CLIP-seq
MIRT1257272	hsa-miR-4280	CLIP-seq
MIRT1257273	hsa-miR-4282	CLIP-seq
MIRT1257274	hsa-miR-4428	CLIP-seq
MIRT1257275	hsa-miR-4480	CLIP-seq
MIRT1257276	hsa-miR-4659a-3p	CLIP-seq
MIRT1257277	hsa-miR-4659b-3p	CLIP-seq
MIRT1257278	hsa-miR-4663	CLIP-seq
MIRT1257279	hsa-miR-4733-5p	CLIP-seq
MIRT1257280	hsa-miR-4770	CLIP-seq
MIRT1257281	hsa-miR-4773	CLIP-seq
MIRT1257282	hsa-miR-4789-5p	CLIP-seq
MIRT1257283	hsa-miR-4803	CLIP-seq
MIRT1257284	hsa-miR-513a-3p	CLIP-seq
MIRT1257285	hsa-miR-518e	CLIP-seq
MIRT1257286	hsa-miR-520d-5p	CLIP-seq
MIRT1257287	hsa-miR-524-5p	CLIP-seq
MIRT1257288	hsa-miR-548an	CLIP-seq
MIRT1257289	hsa-miR-549	CLIP-seq
MIRT1257290	hsa-miR-622	CLIP-seq
MIRT1257291	hsa-miR-628-5p	CLIP-seq
MIRT1257292	hsa-miR-935	CLIP-seq
MIRT1257293	hsa-miR-944	CLIP-seq
MIRT2075828	hsa-miR-1246	CLIP-seq
MIRT2075829	hsa-miR-1257	CLIP-seq
MIRT1257248	hsa-miR-1265	CLIP-seq
MIRT2075830	hsa-miR-1273e	CLIP-seq
MIRT1257249	hsa-miR-1273g	CLIP-seq
MIRT2075831	hsa-miR-129-5p	CLIP-seq
MIRT2075832	hsa-miR-132	CLIP-seq
MIRT1257250	hsa-miR-133a	CLIP-seq
MIRT1257251	hsa-miR-133b	CLIP-seq
MIRT1257253	hsa-miR-150	CLIP-seq
MIRT1257254	hsa-miR-155	CLIP-seq
MIRT1257256	hsa-miR-1911	CLIP-seq
MIRT2075833	hsa-miR-1915	CLIP-seq
MIRT1257257	hsa-miR-192	CLIP-seq
MIRT2075834	hsa-miR-212	CLIP-seq
MIRT1257258	hsa-miR-215	CLIP-seq
MIRT1257260	hsa-miR-2392	CLIP-seq
MIRT1257261	hsa-miR-299-5p	CLIP-seq
MIRT1257263	hsa-miR-3163	CLIP-seq
MIRT2075835	hsa-miR-3190	CLIP-seq
MIRT2075836	hsa-miR-3611	CLIP-seq
MIRT1257266	hsa-miR-365	CLIP-seq
MIRT2075837	hsa-miR-3681	CLIP-seq
MIRT1257267	hsa-miR-3692	CLIP-seq
MIRT1257268	hsa-miR-3714	CLIP-seq
MIRT1257271	hsa-miR-425	CLIP-seq
MIRT1257272	hsa-miR-4280	CLIP-seq
MIRT2075838	hsa-miR-4453	CLIP-seq
MIRT2075839	hsa-miR-4460	CLIP-seq
MIRT1257275	hsa-miR-4480	CLIP-seq
MIRT2075840	hsa-miR-4538	CLIP-seq
MIRT2075841	hsa-miR-455-3p	CLIP-seq
MIRT1257276	hsa-miR-4659a-3p	CLIP-seq
MIRT1257277	hsa-miR-4659b-3p	CLIP-seq
MIRT1257278	hsa-miR-4663	CLIP-seq
MIRT2075842	hsa-miR-4670-3p	CLIP-seq
MIRT2075843	hsa-miR-4724-3p	CLIP-seq
MIRT2075844	hsa-miR-4726-3p	CLIP-seq
MIRT2075845	hsa-miR-4727-3p	CLIP-seq
MIRT2075846	hsa-miR-4736	CLIP-seq
MIRT2075847	hsa-miR-4768-3p	CLIP-seq
MIRT1257281	hsa-miR-4773	CLIP-seq
MIRT1257282	hsa-miR-4789-5p	CLIP-seq
MIRT1257283	hsa-miR-4803	CLIP-seq
MIRT1257284	hsa-miR-513a-3p	CLIP-seq
MIRT1257286	hsa-miR-520d-5p	CLIP-seq
MIRT2075848	hsa-miR-522	CLIP-seq
MIRT1257287	hsa-miR-524-5p	CLIP-seq
MIRT1257288	hsa-miR-548an	CLIP-seq
MIRT1257289	hsa-miR-549	CLIP-seq
MIRT1257291	hsa-miR-628-5p	CLIP-seq
MIRT2075849	hsa-miR-657	CLIP-seq
MIRT2075850	hsa-miR-665	CLIP-seq
MIRT1257292	hsa-miR-935	CLIP-seq
MIRT2075851	hsa-miR-940	CLIP-seq
MIRT1257293	hsa-miR-944	CLIP-seq
MIRT1257248	hsa-miR-1265	CLIP-seq
MIRT2075830	hsa-miR-1273e	CLIP-seq
MIRT1257249	hsa-miR-1273g	CLIP-seq
MIRT2075831	hsa-miR-129-5p	CLIP-seq
MIRT2075832	hsa-miR-132	CLIP-seq
MIRT1257250	hsa-miR-133a	CLIP-seq
MIRT1257251	hsa-miR-133b	CLIP-seq
MIRT1257253	hsa-miR-150	CLIP-seq
MIRT2302462	hsa-miR-151-3p	CLIP-seq
MIRT1257254	hsa-miR-155	CLIP-seq
MIRT1257256	hsa-miR-1911	CLIP-seq
MIRT2075833	hsa-miR-1915	CLIP-seq
MIRT1257257	hsa-miR-192	CLIP-seq
MIRT2075834	hsa-miR-212	CLIP-seq
MIRT2302463	hsa-miR-214	CLIP-seq
MIRT1257258	hsa-miR-215	CLIP-seq
MIRT2302464	hsa-miR-218	CLIP-seq
MIRT1257260	hsa-miR-2392	CLIP-seq
MIRT1257261	hsa-miR-299-5p	CLIP-seq
MIRT2302465	hsa-miR-3120-3p	CLIP-seq
MIRT1257262	hsa-miR-3129-3p	CLIP-seq
MIRT2302466	hsa-miR-3619-5p	CLIP-seq
MIRT1257266	hsa-miR-365	CLIP-seq
MIRT1257267	hsa-miR-3692	CLIP-seq
MIRT1257268	hsa-miR-3714	CLIP-seq
MIRT1257269	hsa-miR-371-5p	CLIP-seq
MIRT1257270	hsa-miR-371b-5p	CLIP-seq
MIRT2302467	hsa-miR-409-5p	CLIP-seq
MIRT1257271	hsa-miR-425	CLIP-seq
MIRT1257273	hsa-miR-4282	CLIP-seq
MIRT2302468	hsa-miR-4463	CLIP-seq
MIRT2302469	hsa-miR-4470	CLIP-seq
MIRT1257275	hsa-miR-4480	CLIP-seq
MIRT2302470	hsa-miR-4499	CLIP-seq
MIRT2302471	hsa-miR-4513	CLIP-seq
MIRT2075841	hsa-miR-455-3p	CLIP-seq
MIRT1257276	hsa-miR-4659a-3p	CLIP-seq
MIRT1257277	hsa-miR-4659b-3p	CLIP-seq
MIRT2302472	hsa-miR-4690-5p	CLIP-seq
MIRT2302473	hsa-miR-4693-5p	CLIP-seq
MIRT2075843	hsa-miR-4724-3p	CLIP-seq
MIRT2075844	hsa-miR-4726-3p	CLIP-seq
MIRT1257279	hsa-miR-4733-5p	CLIP-seq
MIRT2075846	hsa-miR-4736	CLIP-seq
MIRT2302474	hsa-miR-4742-5p	CLIP-seq
MIRT2075847	hsa-miR-4768-3p	CLIP-seq
MIRT1257284	hsa-miR-513a-3p	CLIP-seq
MIRT1257286	hsa-miR-520d-5p	CLIP-seq
MIRT2075848	hsa-miR-522	CLIP-seq
MIRT1257287	hsa-miR-524-5p	CLIP-seq
MIRT2302475	hsa-miR-539	CLIP-seq
MIRT1257288	hsa-miR-548an	CLIP-seq
MIRT2302476	hsa-miR-548g	CLIP-seq
MIRT1257289	hsa-miR-549	CLIP-seq
MIRT1257290	hsa-miR-622	CLIP-seq
MIRT2075849	hsa-miR-657	CLIP-seq
MIRT2075850	hsa-miR-665	CLIP-seq
MIRT2302477	hsa-miR-761	CLIP-seq
MIRT1257292	hsa-miR-935	CLIP-seq
MIRT2075851	hsa-miR-940	CLIP-seq
MIRT1257253	hsa-miR-150	CLIP-seq
MIRT1257266	hsa-miR-365	CLIP-seq
MIRT1257275	hsa-miR-4480	CLIP-seq
MIRT1257276	hsa-miR-4659a-3p	CLIP-seq
MIRT1257277	hsa-miR-4659b-3p	CLIP-seq
MIRT1257279	hsa-miR-4733-5p	CLIP-seq
MIRT1257283	hsa-miR-4803	CLIP-seq
MIRT1257289	hsa-miR-549	CLIP-seq
MIRT1257292	hsa-miR-935	CLIP-seq
MIRT1257253	hsa-miR-150	CLIP-seq
MIRT1257276	hsa-miR-4659a-3p	CLIP-seq
MIRT1257277	hsa-miR-4659b-3p	CLIP-seq
MIRT1257289	hsa-miR-549	CLIP-seq
MIRT1257292	hsa-miR-935	CLIP-seq
MIRT1257249	hsa-miR-1273g	CLIP-seq
MIRT1257250	hsa-miR-133a	CLIP-seq
MIRT1257251	hsa-miR-133b	CLIP-seq
MIRT1257253	hsa-miR-150	CLIP-seq
MIRT1257254	hsa-miR-155	CLIP-seq
MIRT1257255	hsa-miR-183	CLIP-seq
MIRT1257257	hsa-miR-192	CLIP-seq
MIRT1257258	hsa-miR-215	CLIP-seq
MIRT1257259	hsa-miR-216b	CLIP-seq
MIRT2302464	hsa-miR-218	CLIP-seq
MIRT1257261	hsa-miR-299-5p	CLIP-seq
MIRT1257264	hsa-miR-3179	CLIP-seq
MIRT1257265	hsa-miR-3646	CLIP-seq
MIRT1257266	hsa-miR-365	CLIP-seq
MIRT1257269	hsa-miR-371-5p	CLIP-seq
MIRT1257270	hsa-miR-371b-5p	CLIP-seq
MIRT1257272	hsa-miR-4280	CLIP-seq
MIRT1257275	hsa-miR-4480	CLIP-seq
MIRT2302470	hsa-miR-4499	CLIP-seq
MIRT2302471	hsa-miR-4513	CLIP-seq
MIRT1257276	hsa-miR-4659a-3p	CLIP-seq
MIRT1257277	hsa-miR-4659b-3p	CLIP-seq
MIRT1257279	hsa-miR-4733-5p	CLIP-seq
MIRT1257281	hsa-miR-4773	CLIP-seq
MIRT1257283	hsa-miR-4803	CLIP-seq
MIRT1257284	hsa-miR-513a-3p	CLIP-seq
MIRT1257289	hsa-miR-549	CLIP-seq
MIRT1257290	hsa-miR-622	CLIP-seq
MIRT1257292	hsa-miR-935	CLIP-seq
MIRT1257249	hsa-miR-1273g	CLIP-seq
MIRT1257250	hsa-miR-133a	CLIP-seq
MIRT1257251	hsa-miR-133b	CLIP-seq
MIRT1257253	hsa-miR-150	CLIP-seq
MIRT1257254	hsa-miR-155	CLIP-seq
MIRT1257255	hsa-miR-183	CLIP-seq
MIRT1257257	hsa-miR-192	CLIP-seq
MIRT1257258	hsa-miR-215	CLIP-seq
MIRT2302464	hsa-miR-218	CLIP-seq
MIRT1257261	hsa-miR-299-5p	CLIP-seq
MIRT1257266	hsa-miR-365	CLIP-seq
MIRT1257269	hsa-miR-371-5p	CLIP-seq
MIRT1257270	hsa-miR-371b-5p	CLIP-seq
MIRT1257272	hsa-miR-4280	CLIP-seq
MIRT1257275	hsa-miR-4480	CLIP-seq
MIRT2302470	hsa-miR-4499	CLIP-seq
MIRT2302471	hsa-miR-4513	CLIP-seq
MIRT1257281	hsa-miR-4773	CLIP-seq
MIRT1257284	hsa-miR-513a-3p	CLIP-seq
MIRT1257290	hsa-miR-622	CLIP-seq

39 Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000159	Component	Protein phosphatase type 2A complex	IEA
GO:0000159	Component	Protein phosphatase type 2A complex	TAS	8206937
GO:0000278	Process	Mitotic cell cycle	IBA
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000922	Component	Spindle pole	IEA
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004722	Function	Protein serine/threonine phosphatase activity	IBA
GO:0004722	Function	Protein serine/threonine phosphatase activity	IEA
GO:0004722	Function	Protein serine/threonine phosphatase activity	ISS
GO:0004722	Function	Protein serine/threonine phosphatase activity	TAS	8206937, 10640627, 16262633
GO:0005515	Function	Protein binding	IPI	9647778, 10698523, 16085932, 18782753, 19156129, 20969868, 21784977, 25531779, 26496610, 27880917, 28514442, 32814053, 33961781, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006470	Process	Protein dephosphorylation	TAS	2849765
GO:0008637	Process	Apoptotic mitochondrial changes	IEA
GO:0010288	Process	Response to lead ion	IEA
GO:0010288	Process	Response to lead ion	ISS
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IGI	28159925
GO:0010629	Process	Negative regulation of gene expression	IMP	28159925
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IGI	28159925
GO:0016787	Function	Hydrolase activity	IEA
GO:0031113	Process	Regulation of microtubule polymerization	IEA
GO:0034976	Process	Response to endoplasmic reticulum stress	IEA
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IGI	28159925
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0044325	Function	Transmembrane transporter binding	IEA
GO:0046580	Process	Negative regulation of Ras protein signal transduction	IEA
GO:0046677	Process	Response to antibiotic	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0090443	Component	FAR/SIN/STRIPAK complex	IDA	18782753
GO:0090443	Component	FAR/SIN/STRIPAK complex	IEA
GO:1902996	Process	Regulation of neurofibrillary tangle assembly	TAS	16262633

MIM	HGNC	e!Ensembl
176916	9300	ENSG00000104695

P62714

Protein name

Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform (PP2A-beta) (EC 3.1.3.16)

Protein function

Catalytic subunit of protein phosphatase 2A (PP2A), a serine/threonine phosphatase involved in the regulation of a wide variety of enzymes, signal transduction pathways, and cellular events (Probable). PP2A can modulate the activity of phosphory

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00149	Metallophos	50 → 245	Calcineurin-like phosphoesterase	Domain

Sequence

MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL

Sequence length

309

Interactions

View interactions

KEGG Pathway	Reactome Pathway
mRNA surveillance pathway	Inhibition of replication initiation of damaged DNA by RB1/E2F1
Sphingolipid signaling pathway	Spry regulation of FGF signaling
Cell cycle	Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Oocyte meiosis	DARPP-32 events
Autophagy - other	Degradation of beta-catenin by the destruction complex
Autophagy - animal	Beta-catenin phosphorylation cascade
PI3K-Akt signaling pathway	ERK/MAPK targets
AMPK signaling pathway	ERKs are inactivated
Adrenergic signaling in cardiomyocytes	Separation of Sister Chromatids
TGF-beta signaling pathway	Resolution of Sister Chromatid Cohesion
Hippo signaling pathway	CTLA4 inhibitory signaling
Tight junction	Platelet sensitization by LDL
T cell receptor signaling pathway	Disassembly of the destruction complex and recruitment of AXIN to the membrane
Dopaminergic synapse	Misspliced GSK3beta mutants stabilize beta-catenin
Long-term depression	S33 mutants of beta-catenin aren't phosphorylated
Chagas disease	S37 mutants of beta-catenin aren't phosphorylated
Hepatitis C	S45 mutants of beta-catenin aren't phosphorylated
Human papillomavirus infection	T41 mutants of beta-catenin aren't phosphorylated
	APC truncation mutants have impaired AXIN binding
	AXIN missense mutants destabilize the destruction complex
	Truncations of AMER1 destabilize the destruction complex
	RHO GTPases Activate Formins
	RAF activation
	Negative regulation of MAPK pathway
	Regulation of TP53 Degradation
	PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
	Mitotic Prometaphase
	Cyclin D associated events in G1
	Cyclin A/B1/B2 associated events during G2/M transition
	EML4 and NUDC in mitotic spindle formation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (13)
Adenocarcinoma	Adenocarcinoma	BEFREE	23341073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	35142023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	9078303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	9078303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34476575, 38224823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	31464346	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	9078303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23341073, 28159925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33270085	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Porphyria Cutanea Tarda	Porphyria cutanea tarda	Pubtator	34476575	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18460741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18460741	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	9061915		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
PPP2CA	[]	46	["mRNA surveillance pathway","Sphingolipid signaling pathway","Cell cycle","Oocyte meiosis","Autophagy - other","Autophagy - animal","AMPK signaling pathway","Adrenergic signaling in cardiomyocytes","TGF-beta signaling pathway","Hippo signaling pathway","Tight junction","T cell receptor signaling pathway"]	[]
PPP2R1B	[]	43	["mRNA surveillance pathway","Sphingolipid signaling pathway","Cell cycle","Oocyte meiosis","AMPK signaling pathway","Adrenergic signaling in cardiomyocytes","TGF-beta signaling pathway","Hippo signaling pathway","Tight junction","T cell receptor signaling pathway","Dopaminergic synapse","Long-term depression"]	[]
PPP2R1A	[]	44	["mRNA surveillance pathway","Sphingolipid signaling pathway","Cell cycle","Oocyte meiosis","AMPK signaling pathway","Adrenergic signaling in cardiomyocytes","TGF-beta signaling pathway","Hippo signaling pathway","Tight junction","T cell receptor signaling pathway","Dopaminergic synapse","Long-term depression"]	[]
PPP2R5D	[]	33	["mRNA surveillance pathway","Sphingolipid signaling pathway","Cell cycle","Oocyte meiosis","AMPK signaling pathway","Adrenergic signaling in cardiomyocytes","T cell receptor signaling pathway","Dopaminergic synapse","CTLA4 inhibitory signaling","Beta-catenin phosphorylation cascade","Disassembly of the destruction complex and recruitment of AXIN to the membrane","Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal"]	[]
PPP2R5C	[]	31	["mRNA surveillance pathway","Sphingolipid signaling pathway","Cell cycle","Oocyte meiosis","AMPK signaling pathway","Adrenergic signaling in cardiomyocytes","T cell receptor signaling pathway","Dopaminergic synapse","CTLA4 inhibitory signaling","Regulation of TP53 Degradation","Beta-catenin phosphorylation cascade","Disassembly of the destruction complex and recruitment of AXIN to the membrane"]	[]

PPP2CB (protein phosphatase 2 catalytic subunit beta)

Save This Analysis