PPP1R12C (protein phosphatase 1 regulatory subunit 12C)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 54776
• Gene name: Protein phosphatase 1 regulatory subunit 12C
• Gene symbol: PPP1R12C
• Synonyms (NCBI Gene): AAVS1, LENG3, MBS85, p84, p85
• Chromosome: 19
• Chromosome location: 19q13.42
• Summary: The gene encodes a subunit of myosin phosphatase. The encoded protein regulates the catalytic activity of protein phosphatase 1 delta and assembly of the actin cytoskeleton. Alternatively spliced transcript variants encoding multiple isoforms have been ob

miRNA Show/Hide all (175)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027085	hsa-miR-103a-3p	Sequencing	20371350
MIRT028373	hsa-miR-32-5p	Sequencing	20371350
MIRT051961	hsa-let-7b-5p	CLASH	23622248
MIRT038627	hsa-miR-125b-2-3p	CLASH	23622248
MIRT038336	hsa-miR-130b-5p	CLASH	23622248
MIRT714923	hsa-miR-1306-5p	HITS-CLIP	19536157
MIRT714922	hsa-miR-4793-5p	HITS-CLIP	19536157
MIRT714921	hsa-miR-1224-3p	HITS-CLIP	19536157
MIRT714920	hsa-miR-1234-3p	HITS-CLIP	19536157
MIRT714919	hsa-miR-7107-5p	HITS-CLIP	19536157
MIRT714918	hsa-miR-532-3p	HITS-CLIP	19536157
MIRT714917	hsa-miR-6778-3p	HITS-CLIP	19536157
MIRT714916	hsa-miR-1260a	HITS-CLIP	19536157
MIRT714915	hsa-miR-1260b	HITS-CLIP	19536157
MIRT714914	hsa-miR-8057	HITS-CLIP	19536157
MIRT726891	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT726890	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT028373	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT714923	hsa-miR-1306-5p	HITS-CLIP	19536157
MIRT714922	hsa-miR-4793-5p	HITS-CLIP	19536157
MIRT714921	hsa-miR-1224-3p	HITS-CLIP	19536157
MIRT714920	hsa-miR-1234-3p	HITS-CLIP	19536157
MIRT714919	hsa-miR-7107-5p	HITS-CLIP	19536157
MIRT714918	hsa-miR-532-3p	HITS-CLIP	19536157
MIRT714917	hsa-miR-6778-3p	HITS-CLIP	19536157
MIRT714916	hsa-miR-1260a	HITS-CLIP	19536157
MIRT714915	hsa-miR-1260b	HITS-CLIP	19536157
MIRT714914	hsa-miR-8057	HITS-CLIP	19536157
MIRT1255758	hsa-miR-1324	CLIP-seq
MIRT1255759	hsa-miR-1470	CLIP-seq
MIRT1255760	hsa-miR-1908	CLIP-seq
MIRT1255761	hsa-miR-1913	CLIP-seq
MIRT1255762	hsa-miR-1914	CLIP-seq
MIRT1255763	hsa-miR-2114	CLIP-seq
MIRT1255764	hsa-miR-218	CLIP-seq
MIRT1255765	hsa-miR-2467-5p	CLIP-seq
MIRT1255766	hsa-miR-25	CLIP-seq
MIRT1255767	hsa-miR-298	CLIP-seq
MIRT1255768	hsa-miR-3064-5p	CLIP-seq
MIRT1255769	hsa-miR-3121-3p	CLIP-seq
MIRT1255770	hsa-miR-3153	CLIP-seq
MIRT1255771	hsa-miR-3179	CLIP-seq
MIRT1255772	hsa-miR-3188	CLIP-seq
MIRT1255773	hsa-miR-3189-5p	CLIP-seq
MIRT1255774	hsa-miR-32	CLIP-seq
MIRT1255775	hsa-miR-3202	CLIP-seq
MIRT1255776	hsa-miR-324-3p	CLIP-seq
MIRT1255777	hsa-miR-342-5p	CLIP-seq
MIRT1255778	hsa-miR-3613-3p	CLIP-seq
MIRT1255779	hsa-miR-363	CLIP-seq
MIRT1255780	hsa-miR-3664-3p	CLIP-seq
MIRT1255781	hsa-miR-367	CLIP-seq
MIRT1255782	hsa-miR-3688-5p	CLIP-seq
MIRT1255783	hsa-miR-3936	CLIP-seq
MIRT1255784	hsa-miR-3975	CLIP-seq
MIRT1255785	hsa-miR-4271	CLIP-seq
MIRT1255786	hsa-miR-4433	CLIP-seq
MIRT1255787	hsa-miR-4438	CLIP-seq
MIRT1255788	hsa-miR-4459	CLIP-seq
MIRT1255789	hsa-miR-4466	CLIP-seq
MIRT1255790	hsa-miR-4642	CLIP-seq
MIRT1255791	hsa-miR-4649-3p	CLIP-seq
MIRT1255792	hsa-miR-4651	CLIP-seq
MIRT1255793	hsa-miR-4664-5p	CLIP-seq
MIRT1255794	hsa-miR-4667-3p	CLIP-seq
MIRT1255795	hsa-miR-4706	CLIP-seq
MIRT1255796	hsa-miR-4713-5p	CLIP-seq
MIRT1255797	hsa-miR-4717-3p	CLIP-seq
MIRT1255798	hsa-miR-4724-3p	CLIP-seq
MIRT1255799	hsa-miR-4725-3p	CLIP-seq
MIRT1255800	hsa-miR-4728-5p	CLIP-seq
MIRT1255801	hsa-miR-4747-5p	CLIP-seq
MIRT1255802	hsa-miR-4749-5p	CLIP-seq
MIRT1255803	hsa-miR-4758-3p	CLIP-seq
MIRT1255804	hsa-miR-4768-3p	CLIP-seq
MIRT1255805	hsa-miR-4779	CLIP-seq
MIRT1255806	hsa-miR-4802-3p	CLIP-seq
MIRT1255807	hsa-miR-485-5p	CLIP-seq
MIRT1255808	hsa-miR-486-3p	CLIP-seq
MIRT1255809	hsa-miR-5095	CLIP-seq
MIRT1255810	hsa-miR-545	CLIP-seq
MIRT1255811	hsa-miR-548p	CLIP-seq
MIRT1255812	hsa-miR-550a	CLIP-seq
MIRT1255813	hsa-miR-608	CLIP-seq
MIRT1255814	hsa-miR-625	CLIP-seq
MIRT1255815	hsa-miR-636	CLIP-seq
MIRT1255816	hsa-miR-644	CLIP-seq
MIRT1255817	hsa-miR-663	CLIP-seq
MIRT1255818	hsa-miR-675	CLIP-seq
MIRT1255819	hsa-miR-711	CLIP-seq
MIRT1255820	hsa-miR-767-3p	CLIP-seq
MIRT1255821	hsa-miR-92a	CLIP-seq
MIRT1255822	hsa-miR-92b	CLIP-seq
MIRT2075357	hsa-miR-1247	CLIP-seq
MIRT2075358	hsa-miR-1273f	CLIP-seq
MIRT2075359	hsa-miR-1291	CLIP-seq
MIRT2075360	hsa-miR-1343	CLIP-seq
MIRT2075361	hsa-miR-143	CLIP-seq
MIRT2075362	hsa-miR-3128	CLIP-seq
MIRT2075363	hsa-miR-3144-5p	CLIP-seq
MIRT2075364	hsa-miR-3176	CLIP-seq
MIRT2075365	hsa-miR-3191	CLIP-seq
MIRT2075366	hsa-miR-326	CLIP-seq
MIRT2075367	hsa-miR-328	CLIP-seq
MIRT2075368	hsa-miR-330-5p	CLIP-seq
MIRT2075369	hsa-miR-3649	CLIP-seq
MIRT2075370	hsa-miR-3663-5p	CLIP-seq
MIRT2075371	hsa-miR-3667-3p	CLIP-seq
MIRT2075372	hsa-miR-3922-3p	CLIP-seq
MIRT2075373	hsa-miR-3937	CLIP-seq
MIRT2075374	hsa-miR-4281	CLIP-seq
MIRT1255790	hsa-miR-4642	CLIP-seq
MIRT2075375	hsa-miR-4645-5p	CLIP-seq
MIRT1255792	hsa-miR-4651	CLIP-seq
MIRT2075376	hsa-miR-4652-5p	CLIP-seq
MIRT2075377	hsa-miR-4673	CLIP-seq
MIRT2075378	hsa-miR-4708-5p	CLIP-seq
MIRT2075379	hsa-miR-4720-5p	CLIP-seq
MIRT2075380	hsa-miR-4770	CLIP-seq
MIRT2075381	hsa-miR-4794	CLIP-seq
MIRT2075382	hsa-miR-4799-3p	CLIP-seq
MIRT2075383	hsa-miR-593	CLIP-seq
MIRT1255813	hsa-miR-608	CLIP-seq
MIRT1255758	hsa-miR-1324	CLIP-seq
MIRT2075360	hsa-miR-1343	CLIP-seq
MIRT1255759	hsa-miR-1470	CLIP-seq
MIRT1255760	hsa-miR-1908	CLIP-seq
MIRT1255761	hsa-miR-1913	CLIP-seq
MIRT1255762	hsa-miR-1914	CLIP-seq
MIRT1255764	hsa-miR-218	CLIP-seq
MIRT1255766	hsa-miR-25	CLIP-seq
MIRT1255767	hsa-miR-298	CLIP-seq
MIRT1255769	hsa-miR-3121-3p	CLIP-seq
MIRT1255771	hsa-miR-3179	CLIP-seq
MIRT1255773	hsa-miR-3189-5p	CLIP-seq
MIRT1255774	hsa-miR-32	CLIP-seq
MIRT1255775	hsa-miR-3202	CLIP-seq
MIRT1255776	hsa-miR-324-3p	CLIP-seq
MIRT1255777	hsa-miR-342-5p	CLIP-seq
MIRT1255778	hsa-miR-3613-3p	CLIP-seq
MIRT1255779	hsa-miR-363	CLIP-seq
MIRT1255781	hsa-miR-367	CLIP-seq
MIRT1255782	hsa-miR-3688-5p	CLIP-seq
MIRT2301980	hsa-miR-377	CLIP-seq
MIRT1255783	hsa-miR-3936	CLIP-seq
MIRT1255785	hsa-miR-4271	CLIP-seq
MIRT2301981	hsa-miR-432	CLIP-seq
MIRT1255787	hsa-miR-4438	CLIP-seq
MIRT1255793	hsa-miR-4664-5p	CLIP-seq
MIRT1255794	hsa-miR-4667-3p	CLIP-seq
MIRT1255795	hsa-miR-4706	CLIP-seq
MIRT1255796	hsa-miR-4713-5p	CLIP-seq
MIRT1255797	hsa-miR-4717-3p	CLIP-seq
MIRT1255798	hsa-miR-4724-3p	CLIP-seq
MIRT1255799	hsa-miR-4725-3p	CLIP-seq
MIRT1255800	hsa-miR-4728-5p	CLIP-seq
MIRT1255801	hsa-miR-4747-5p	CLIP-seq
MIRT1255802	hsa-miR-4749-5p	CLIP-seq
MIRT1255803	hsa-miR-4758-3p	CLIP-seq
MIRT1255806	hsa-miR-4802-3p	CLIP-seq
MIRT1255808	hsa-miR-486-3p	CLIP-seq
MIRT1255809	hsa-miR-5095	CLIP-seq
MIRT1255810	hsa-miR-545	CLIP-seq
MIRT1255811	hsa-miR-548p	CLIP-seq
MIRT1255812	hsa-miR-550a	CLIP-seq
MIRT2301982	hsa-miR-568	CLIP-seq
MIRT2301983	hsa-miR-602	CLIP-seq
MIRT1255814	hsa-miR-625	CLIP-seq
MIRT1255815	hsa-miR-636	CLIP-seq
MIRT1255816	hsa-miR-644	CLIP-seq
MIRT2301984	hsa-miR-646	CLIP-seq
MIRT1255817	hsa-miR-663	CLIP-seq
MIRT1255819	hsa-miR-711	CLIP-seq
MIRT1255821	hsa-miR-92a	CLIP-seq
MIRT1255822	hsa-miR-92b	CLIP-seq

Gene ontology (GO) Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001725	Component	Stress fiber	IEA
GO:0004857	Function	Enzyme inhibitor activity	IBA
GO:0005515	Function	Protein binding	IPI	12080061, 21988832, 22153077, 25416956, 27812135, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0017020	Function	Myosin phosphatase regulator activity	IBA
GO:0019208	Function	Phosphatase regulator activity	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0048812	Process	Neuron projection morphogenesis	IBA

Other IDs

• MIM: 613245
• HGNC: 14947
• e!Ensembl: ENSG00000125503

Protein

• UniProt ID: Q9BZL4
• Protein name: Protein phosphatase 1 regulatory subunit 12C (Protein phosphatase 1 myosin-binding subunit of 85 kDa) (Protein phosphatase 1 myosin-binding subunit p85)
• Protein function: Regulates myosin phosphatase activity.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12796	Ank_2	55 → 164	Ankyrin repeats (3 copies)	Repeat
  PF12796	Ank_2	196 → 290	Ankyrin repeats (3 copies)	Repeat
  PF13637	Ank_4	101 → 154		Repeat
  PF15898	PRKG1_interact	682 → 782	cGMP-dependent protein kinase interacting domain	Coiled-coil

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed. Highly expressed in heart. {ECO:0000269|PubMed:11399775}.
• Sequence:

  MSGEDGPAAGPGAAAAAARERRREQLRQWGARAGAEPGPGERRARTVRFERAAEFLAACA
  GGDLDEARLMLRAADPGPGAELDPAAPPPARAVLDSTNADGISALHQACIDENLEVVRFL
  VEQGATVNQADNEGWTPLHVAASCGYLDIARYLLSHGANIAAVNSDGDLPLDLAESDAME
  GLLKAEIARRGVDVEAAKRAEEELLLHDTRCWLNGGAMPEARHPRTGASALHVAAAKGYI
  EVMRLLLQAGYDPELRDGDGWTPLHAAAHWGVEDACRLLAEHGGGMDSLTHAGQRPCDLA
  DEEVLSLLEELARKQEDLRNQKEASQSRGQEPQAPSSSKHRRSSVCRLSSREKISLQDLS
  KERRPGGAGGPPIQDEDEGEEGPTEPPPAEPRTLNGVSSPPHPSPKSPVQLEEAPFSRRF
  GLLKTGSSGALGPPERRTAEGAPGAGLQRSASSSWLEGTSTQAKELRLARITPTPSPKLP
  EPSVLSEVTKPPPCLENSSPPSRIPEPESPAKPNVPTASTAPPADSRDRRRSYQMPVRDE
  ESESQRKARSRLMRQSRRSTQGVTLTDLKEAEKAAGKAPESEKPAQSLDPSRRPRVPGVE
  NSDSPAQRAEAPDGQGPGPQAAREHRKVGKEWRGPAEGEEAEPADRSQESSTLEGGPSAR
  RQRWQRDLNPEPEPESEEPDGGFRTLYAELRRENERLREALTETTLRLAQLKVELERATQ
  RQERFAERPALLELERFERRALERKAAELEEELKALSDLRADNQRLKDENAALIRVISKL
  SK

• Sequence length: 782

Pathways

KEGG Pathway

Vascular smooth muscle contraction

Focal adhesion

Regulation of actin cytoskeleton

Oxytocin signaling pathway

Proteoglycans in cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (99)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	1310887		★☆☆☆☆ Found in Text Mining only
alpha 1-Antitrypsin Deficiency	Alpha 1-Antitrypsin Deficiency	BEFREE	21609134		★☆☆☆☆ Found in Text Mining only
Alpha-Sarcoglycanopathies	Limb-girdle muscular dystrophy	BEFREE	21031578		★☆☆☆☆ Found in Text Mining only
Angioedemas, Hereditary	Angioedema	BEFREE	30059156		★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	BEFREE	25857910		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	15975012, 17266422		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16579640, 23222510, 28027535		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	10077559	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	1310887		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31160686		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28589503		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	33868646	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis progressive familial intrahepatic 2	Cholelithiasis	Pubtator	33868646	Associate	★☆☆☆☆ Found in Text Mining only
Choroideremia	Choroideremia	BEFREE	29707603, 29932012		★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	25288370		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22623730		★☆☆☆☆ Found in Text Mining only
Citrullinemia Type 1	Citrullinemia	BEFREE	24131980		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	19072910		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26864651, 7541019		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31217502		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28169951, 29703647, 30885011		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29288416		★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	29259248		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	10890777, 15507460, 24869933, 28657358, 28726496, 7679117		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	14712302		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22808093		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	31160686		★☆☆☆☆ Found in Text Mining only
Erythrocytosis familial, 1	Erythrocytosis	BEFREE	19336760		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	24859981		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	24859981		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28283349		★☆☆☆☆ Found in Text Mining only
Generalized glycogen storage disease of infants	Glycogen Storage Disease	BEFREE	29731431, 29901418		★☆☆☆☆ Found in Text Mining only
GIANT AXONAL NEUROPATHY 1	Giant Axonal Neuropathy	BEFREE	29249183		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	15975850		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	12542846, 18328427		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	12542846, 18328427		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	12542846		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	29953879		★☆☆☆☆ Found in Text Mining only
Globoid cell leukodystrophy	Globoid Cell Leukodystrophy	BEFREE	29316812		★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type Ia	Glycogen Storage Disease	BEFREE	29802554		★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	29731431, 29901418		★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	25288370	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease, Chronic, X-Linked	Granulomatous Disease	BEFREE	21411759, 26295532		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	29496059		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	28169951		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28169951, 29703647, 30885011		★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	15975012, 17266422, 28411016, 28460646, 30975639, 31808868		★☆☆☆☆ Found in Text Mining only
Hemophilia B	Hemophilia	BEFREE	12463593, 15975012, 20424599, 24460861, 25419787, 26524468, 27834949, 28112377, 28480313		★☆☆☆☆ Found in Text Mining only
Hemophilia, NOS	Hemophilia	BEFREE	17266422, 28460646, 30975639		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11986952		★☆☆☆☆ Found in Text Mining only
Homocystinuria	Homocystinuria	BEFREE	17202841		★☆☆☆☆ Found in Text Mining only
Hyperopia	Hyperopia	BEFREE	29170418		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	24469048		★☆☆☆☆ Found in Text Mining only
Late-Infantile Neuronal Ceroid Lipfuscinosis	Neuronal Ceroid Lipofuscinosis	BEFREE	16452657		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30217986		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	30217986		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	11986952		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	9538131		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	29496059		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23222510, 28027535		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	29288416		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	1310887		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28012929, 28614092, 31428587		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16131837, 23270540, 27827005, 28630349, 28743532, 29246942, 29616047		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26864651		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	31649957		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	28223140		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	24555840		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	9857977		★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis III	Mucopolysaccharidosis	BEFREE	29064732		★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis Type IIIA	Mucopolysaccharidosis	BEFREE	29064732		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	19286672		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophies, Limb-Girdle	Limb-Girdle Muscular Dystrophy	BEFREE	10933922		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	21967249, 26414293, 29781327		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	26495845		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	29409973, 30662656		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12542846, 14741778, 16917505, 21996737, 25501993, 27130196, 27827005, 29588411, 31160686, 9538131		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	22465202, 25183392		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	23600720, 28425480		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	29776328		★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	29781327		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24550137		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22808093		★☆☆☆☆ Found in Text Mining only
Ornithine carbamoyltransferase deficiency	Ornithine Carbamoyltransferase Deficiency	BEFREE	28283349		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26499077		★☆☆☆☆ Found in Text Mining only
Parkinsonism-Dystonia, Infantile	Parkinsonism-dystonia	BEFREE	28417953		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	11440917		★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	BEFREE	19336760		★☆☆☆☆ Found in Text Mining only
Primary hyperoxaluria, type I	Hyperoxaluria	BEFREE	31402115		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28012929, 28614092, 31428587		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	29288416		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29288416		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	25619725		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16802345		★☆☆☆☆ Found in Text Mining only
Sandhoff Disease	Sandhoff Disease	BEFREE	25474439, 25971245		★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	BEFREE	10890777		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	29249183, 29781327		★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	24833591		★☆☆☆☆ Found in Text Mining only
X-Linked Combined Immunodeficiency Diseases	Combined Immunodeficiency, X-Linked	BEFREE	29606506		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

PPP1R12B 5 shared pathwaysVascular smooth muscle contraction, Focal adhesion, Regulation of actin cytoskeleton, Oxytocin signaling pathway, Proteoglycans in cancer Related via 5 shared pathways including Vascular smooth muscle contraction, Focal adhesion. PPP1R12A 5 shared pathwaysVascular smooth muscle contraction, Focal adhesion, Regulation of actin cytoskeleton, Oxytocin signaling pathway, Proteoglycans in cancer Related via 5 shared pathways including Vascular smooth muscle contraction, Focal adhesion. MYLK4 4 shared pathwaysVascular smooth muscle contraction, Focal adhesion, Regulation of actin cytoskeleton, Oxytocin signaling pathway Related via 4 shared pathways including Vascular smooth muscle contraction, Focal adhesion. MYLK2 4 shared pathwaysVascular smooth muscle contraction, Focal adhesion, Regulation of actin cytoskeleton, Oxytocin signaling pathway Related via 4 shared pathways including Vascular smooth muscle contraction, Focal adhesion. MYLK3 4 shared pathwaysVascular smooth muscle contraction, Focal adhesion, Regulation of actin cytoskeleton, Oxytocin signaling pathway Related via 4 shared pathways including Vascular smooth muscle contraction, Focal adhesion.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PPP1R12B	0	[]	5	["Vascular smooth muscle contraction","Focal adhesion","Regulation of actin cytoskeleton","Oxytocin signaling pathway","Proteoglycans in cancer"]	0	[]
PPP1R12A	0	[]	5	["Vascular smooth muscle contraction","Focal adhesion","Regulation of actin cytoskeleton","Oxytocin signaling pathway","Proteoglycans in cancer"]	0	[]
MYLK4	0	[]	4	["Vascular smooth muscle contraction","Focal adhesion","Regulation of actin cytoskeleton","Oxytocin signaling pathway"]	0	[]
MYLK2	0	[]	4	["Vascular smooth muscle contraction","Focal adhesion","Regulation of actin cytoskeleton","Oxytocin signaling pathway"]	0	[]
MYLK3	0	[]	4	["Vascular smooth muscle contraction","Focal adhesion","Regulation of actin cytoskeleton","Oxytocin signaling pathway"]	0	[]

Diseases Linked via Similar Genes

Dilated cardiomyopathy Linked via 2 of 5 related genesMYLK2, MYLK3 Thyroid gland neoplasms Linked via 1 of 5 related genesPPP1R12B Breast neoplasms Linked via 1 of 5 related genesPPP1R12B Lobular carcinoma Linked via 1 of 5 related genesPPP1R12B Celiac disease Linked via 1 of 5 related genesPPP1R12B

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Dilated cardiomyopathy	2	["MYLK2","MYLK3"]
Thyroid gland neoplasms	1	["PPP1R12B"]
Breast neoplasms	1	["PPP1R12B"]
Lobular carcinoma	1	["PPP1R12B"]
Celiac disease	1	["PPP1R12B"]