POLR2J (RNA polymerase II subunit J)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 5439
• Gene name: RNA polymerase II subunit J
• Gene symbol: POLR2J
• Synonyms (NCBI Gene): POLR2J1, RPB11, RPB11A, RPB11m, hRPB14
• Chromosome: 7
• Chromosome location: 7q22.1
• Summary: This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene exists as a heterodimer with another polymerase subunit; together they form a core subassembly unit of the

miRNA Show/Hide all (122)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022854	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT1248910	hsa-miR-1197	CLIP-seq
MIRT1248911	hsa-miR-1273e	CLIP-seq
MIRT1248912	hsa-miR-1304	CLIP-seq
MIRT1248913	hsa-miR-219-1-3p	CLIP-seq
MIRT1248914	hsa-miR-224	CLIP-seq
MIRT1248915	hsa-miR-2278	CLIP-seq
MIRT1248916	hsa-miR-2467-5p	CLIP-seq
MIRT1248917	hsa-miR-3163	CLIP-seq
MIRT1248918	hsa-miR-3184	CLIP-seq
MIRT1248919	hsa-miR-3188	CLIP-seq
MIRT1248920	hsa-miR-3649	CLIP-seq
MIRT1248921	hsa-miR-3652	CLIP-seq
MIRT1248922	hsa-miR-3689a-3p	CLIP-seq
MIRT1248923	hsa-miR-3689c	CLIP-seq
MIRT1248924	hsa-miR-3975	CLIP-seq
MIRT1248925	hsa-miR-423-5p	CLIP-seq
MIRT1248926	hsa-miR-4300	CLIP-seq
MIRT1248927	hsa-miR-4327	CLIP-seq
MIRT1248928	hsa-miR-4430	CLIP-seq
MIRT1248929	hsa-miR-4433	CLIP-seq
MIRT1248930	hsa-miR-4436a	CLIP-seq
MIRT1248931	hsa-miR-4457	CLIP-seq
MIRT1248932	hsa-miR-4468	CLIP-seq
MIRT1248933	hsa-miR-4505	CLIP-seq
MIRT1248934	hsa-miR-4514	CLIP-seq
MIRT1248935	hsa-miR-4651	CLIP-seq
MIRT1248936	hsa-miR-4692	CLIP-seq
MIRT1248937	hsa-miR-4700-3p	CLIP-seq
MIRT1248938	hsa-miR-4701-5p	CLIP-seq
MIRT1248939	hsa-miR-4710	CLIP-seq
MIRT1248940	hsa-miR-4777-5p	CLIP-seq
MIRT1248941	hsa-miR-485-5p	CLIP-seq
MIRT1248942	hsa-miR-518d-5p	CLIP-seq
MIRT1248943	hsa-miR-519b-5p	CLIP-seq
MIRT1248944	hsa-miR-519c-5p	CLIP-seq
MIRT1248945	hsa-miR-520c-5p	CLIP-seq
MIRT1248946	hsa-miR-526a	CLIP-seq
MIRT1248947	hsa-miR-548aa	CLIP-seq
MIRT1248948	hsa-miR-588	CLIP-seq
MIRT1248949	hsa-miR-608	CLIP-seq
MIRT1248950	hsa-miR-635	CLIP-seq
MIRT1248951	hsa-miR-665	CLIP-seq
MIRT1248952	hsa-miR-767-3p	CLIP-seq
MIRT1248953	hsa-miR-920	CLIP-seq
MIRT1248954	hsa-miR-940	CLIP-seq
MIRT2073500	hsa-miR-1263	CLIP-seq
MIRT1248912	hsa-miR-1304	CLIP-seq
MIRT1248913	hsa-miR-219-1-3p	CLIP-seq
MIRT1248915	hsa-miR-2278	CLIP-seq
MIRT1248916	hsa-miR-2467-5p	CLIP-seq
MIRT1248919	hsa-miR-3188	CLIP-seq
MIRT2073501	hsa-miR-3670	CLIP-seq
MIRT1248922	hsa-miR-3689a-3p	CLIP-seq
MIRT1248923	hsa-miR-3689c	CLIP-seq
MIRT1248924	hsa-miR-3975	CLIP-seq
MIRT2073502	hsa-miR-4254	CLIP-seq
MIRT2073503	hsa-miR-4269	CLIP-seq
MIRT1248926	hsa-miR-4300	CLIP-seq
MIRT1248929	hsa-miR-4433	CLIP-seq
MIRT1248932	hsa-miR-4468	CLIP-seq
MIRT1248934	hsa-miR-4514	CLIP-seq
MIRT2073504	hsa-miR-4536	CLIP-seq
MIRT1248936	hsa-miR-4692	CLIP-seq
MIRT2073505	hsa-miR-4742-5p	CLIP-seq
MIRT1248940	hsa-miR-4777-5p	CLIP-seq
MIRT1248941	hsa-miR-485-5p	CLIP-seq
MIRT2073506	hsa-miR-507	CLIP-seq
MIRT1248942	hsa-miR-518d-5p	CLIP-seq
MIRT1248943	hsa-miR-519b-5p	CLIP-seq
MIRT1248944	hsa-miR-519c-5p	CLIP-seq
MIRT1248945	hsa-miR-520c-5p	CLIP-seq
MIRT1248946	hsa-miR-526a	CLIP-seq
MIRT2073507	hsa-miR-557	CLIP-seq
MIRT2073508	hsa-miR-619	CLIP-seq
MIRT2073509	hsa-miR-629	CLIP-seq
MIRT1248950	hsa-miR-635	CLIP-seq
MIRT2073510	hsa-miR-658	CLIP-seq
MIRT1248951	hsa-miR-665	CLIP-seq
MIRT1248952	hsa-miR-767-3p	CLIP-seq
MIRT1248953	hsa-miR-920	CLIP-seq
MIRT1248918	hsa-miR-3184	CLIP-seq
MIRT2300504	hsa-miR-3914	CLIP-seq
MIRT1248925	hsa-miR-423-5p	CLIP-seq
MIRT2073502	hsa-miR-4254	CLIP-seq
MIRT2073503	hsa-miR-4269	CLIP-seq
MIRT2300505	hsa-miR-4283	CLIP-seq
MIRT2300506	hsa-miR-4284	CLIP-seq
MIRT2300507	hsa-miR-4437	CLIP-seq
MIRT1248931	hsa-miR-4457	CLIP-seq
MIRT1248932	hsa-miR-4468	CLIP-seq
MIRT2300508	hsa-miR-4508	CLIP-seq
MIRT1248934	hsa-miR-4514	CLIP-seq
MIRT1248935	hsa-miR-4651	CLIP-seq
MIRT1248936	hsa-miR-4692	CLIP-seq
MIRT1248938	hsa-miR-4701-5p	CLIP-seq
MIRT1248939	hsa-miR-4710	CLIP-seq
MIRT2073505	hsa-miR-4742-5p	CLIP-seq
MIRT2300509	hsa-miR-513a-5p	CLIP-seq
MIRT1248948	hsa-miR-588	CLIP-seq
MIRT1248949	hsa-miR-608	CLIP-seq
MIRT2073510	hsa-miR-658	CLIP-seq
MIRT2073501	hsa-miR-3670	CLIP-seq
MIRT1248926	hsa-miR-4300	CLIP-seq
MIRT2073506	hsa-miR-507	CLIP-seq
MIRT2073507	hsa-miR-557	CLIP-seq
MIRT2073509	hsa-miR-629	CLIP-seq
MIRT1248953	hsa-miR-920	CLIP-seq
MIRT1248918	hsa-miR-3184	CLIP-seq
MIRT1248925	hsa-miR-423-5p	CLIP-seq
MIRT1248931	hsa-miR-4457	CLIP-seq
MIRT1248935	hsa-miR-4651	CLIP-seq
MIRT1248938	hsa-miR-4701-5p	CLIP-seq
MIRT1248948	hsa-miR-588	CLIP-seq
MIRT1248949	hsa-miR-608	CLIP-seq
MIRT1248918	hsa-miR-3184	CLIP-seq
MIRT1248925	hsa-miR-423-5p	CLIP-seq
MIRT1248931	hsa-miR-4457	CLIP-seq
MIRT1248935	hsa-miR-4651	CLIP-seq
MIRT1248938	hsa-miR-4701-5p	CLIP-seq
MIRT1248948	hsa-miR-588	CLIP-seq
MIRT1248949	hsa-miR-608	CLIP-seq

Gene ontology (GO) Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000428	Component	DNA-directed RNA polymerase complex	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003899	Function	DNA-directed RNA polymerase activity	IBA
GO:0003899	Function	DNA-directed RNA polymerase activity	IEA
GO:0003899	Function	DNA-directed RNA polymerase activity	TAS	8797801
GO:0005515	Function	Protein binding	IPI	10783144, 21988832, 25416956, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	9852112
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005665	Component	RNA polymerase II, core complex	IBA
GO:0005665	Component	RNA polymerase II, core complex	IDA	9852112
GO:0005665	Component	RNA polymerase II, core complex	IEA
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IBA
GO:0006366	Process	Transcription by RNA polymerase II	IDA	9852112
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0030275	Function	LRR domain binding	IPI	10783144
GO:0046983	Function	Protein dimerization activity	IEA

Other IDs

• MIM: 604150
• HGNC: 9197
• e!Ensembl: ENSG00000005075

Protein

• UniProt ID: P52435
• Protein name: DNA-directed RNA polymerase II subunit RPB11-a (RNA polymerase II subunit B11-a) (RPB11a) (DNA-directed RNA polymerase II subunit J-1) (RNA polymerase II 13.3 kDa subunit)
• Protein function: Core component of RNA polymerase II (Pol II), a DNA-dependent RNA polymerase which synthesizes mRNA precursors and many functional non-coding RNAs using the four ribonucleoside triphosphates as substrates. {ECO:0000269|PubMed:27193682, ECO:00002
• PDB: 5IY6 , 5IY7 , 5IY8 , 5IY9 , 5IYA , 5IYB , 5IYC , 5IYD , 6DRD , 6O9L , 6XRE , 7LBM , 9EHZ , 9EI1 , 9EI3 , 9EI4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13656	RNA_pol_L_2	30 → 104	RNA polymerase Rpb3/Rpb11 dimerisation domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed. High expression was found in heart and skeletal muscle. {ECO:0000269|PubMed:11747469}.
• Sequence:

  MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG
  YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE

• Sequence length: 117

Pathways

KEGG Pathway	Reactome Pathway
RNA polymerase	Formation of RNA Pol II elongation complex
Nucleotide excision repair	Formation of the Early Elongation Complex
Huntington disease	Formation of HIV-1 elongation complex containing HIV-1 Tat
	Viral Messenger RNA Synthesis
	MicroRNA (miRNA) biogenesis
	Transcriptional regulation by small RNAs
	RNA Polymerase II Pre-transcription Events
	Formation of TC-NER Pre-Incision Complex
	Transcription-Coupled Nucleotide Excision Repair (TC-NER)
	Dual incision in TC-NER
	Gap-filling DNA repair synthesis and ligation in TC-NER
	TP53 Regulates Transcription of DNA Repair Genes
	FGFR2 alternative splicing
	RNA polymerase II transcribes snRNA genes
	mRNA Capping
	mRNA Splicing - Major Pathway
	mRNA Splicing - Minor Pathway
	Processing of Capped Intron-Containing Pre-mRNA
	RNA Polymerase II Promoter Escape
	RNA Polymerase II Transcription Pre-Initiation And Promoter Opening
	RNA Polymerase II Transcription Initiation
	RNA Polymerase II Transcription Elongation
	RNA Polymerase II Transcription Initiation And Promoter Clearance
	RNA Pol II CTD phosphorylation and interaction with CE
	Estrogen-dependent gene expression

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
BREAST CANCER	—	GWAS catalog	29059683	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	29059683	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	37551622	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

POLR2A 27 shared pathwaysRNA polymerase, Nucleotide excision repair, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway, mRNA Splicing - Minor Pathway +15 more Related via 27 shared pathways including RNA polymerase, Nucleotide excision repair. POLR2B 27 shared pathwaysRNA polymerase, Nucleotide excision repair, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway, mRNA Splicing - Minor Pathway +15 more Related via 27 shared pathways including RNA polymerase, Nucleotide excision repair. POLR2C 27 shared pathwaysRNA polymerase, Nucleotide excision repair, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway, mRNA Splicing - Minor Pathway +15 more Related via 27 shared pathways including RNA polymerase, Nucleotide excision repair. POLR2D 27 shared pathwaysRNA polymerase, Nucleotide excision repair, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway, mRNA Splicing - Minor Pathway +15 more Related via 27 shared pathways including RNA polymerase, Nucleotide excision repair. POLR2G 27 shared pathwaysRNA polymerase, Nucleotide excision repair, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway, mRNA Splicing - Minor Pathway +15 more Related via 27 shared pathways including RNA polymerase, Nucleotide excision repair.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
POLR2A	0	[]	27	["RNA polymerase","Nucleotide excision repair","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway","mRNA Splicing - Minor Pathway"]	0	[]
POLR2B	0	[]	27	["RNA polymerase","Nucleotide excision repair","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway","mRNA Splicing - Minor Pathway"]	0	[]
POLR2C	0	[]	27	["RNA polymerase","Nucleotide excision repair","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway","mRNA Splicing - Minor Pathway"]	0	[]
POLR2D	0	[]	27	["RNA polymerase","Nucleotide excision repair","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway","mRNA Splicing - Minor Pathway"]	0	[]
POLR2G	0	[]	27	["RNA polymerase","Nucleotide excision repair","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway","mRNA Splicing - Minor Pathway"]	0	[]

Diseases Linked via Similar Genes

Atrial fibrillation Linked via 1 of 5 related genesPOLR2A Cardioembolic stroke Linked via 1 of 5 related genesPOLR2A Central nervous system cancer Linked via 1 of 5 related genesPOLR2A Developmental disability Linked via 1 of 5 related genesPOLR2A Endometriosis Linked via 1 of 5 related genesPOLR2A

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Atrial fibrillation	1	["POLR2A"]
Cardioembolic stroke	1	["POLR2A"]
Central nervous system cancer	1	["POLR2A"]
Developmental disability	1	["POLR2A"]
Endometriosis	1	["POLR2A"]