POLR2G (RNA polymerase II subunit G)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 5436
• Gene name: RNA polymerase II subunit G
• Gene symbol: POLR2G
• Synonyms (NCBI Gene): RPB19, RPB7, hRPB19, hsRPB7
• Chromosome: 11
• Chromosome location: 11q12.3
• Summary: This gene encodes the seventh largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The protein functions in transcription initiation, and is also thought to help stabilize transcribing polyermase m

miRNA Show/Hide all (149)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028902	hsa-miR-26b-5p	Microarray	19088304
MIRT1248766	hsa-miR-1237	CLIP-seq
MIRT1248767	hsa-miR-1255a	CLIP-seq
MIRT1248768	hsa-miR-1255b	CLIP-seq
MIRT1248769	hsa-miR-219-1-3p	CLIP-seq
MIRT1248770	hsa-miR-3152-5p	CLIP-seq
MIRT1248771	hsa-miR-3161	CLIP-seq
MIRT1248772	hsa-miR-3192	CLIP-seq
MIRT1248773	hsa-miR-3654	CLIP-seq
MIRT1248774	hsa-miR-3667-3p	CLIP-seq
MIRT1248775	hsa-miR-378	CLIP-seq
MIRT1248776	hsa-miR-378b	CLIP-seq
MIRT1248777	hsa-miR-378c	CLIP-seq
MIRT1248778	hsa-miR-378d	CLIP-seq
MIRT1248779	hsa-miR-378e	CLIP-seq
MIRT1248780	hsa-miR-378f	CLIP-seq
MIRT1248781	hsa-miR-378h	CLIP-seq
MIRT1248782	hsa-miR-378i	CLIP-seq
MIRT1248783	hsa-miR-422a	CLIP-seq
MIRT1248784	hsa-miR-4297	CLIP-seq
MIRT1248785	hsa-miR-4314	CLIP-seq
MIRT1248786	hsa-miR-4423-5p	CLIP-seq
MIRT1248787	hsa-miR-4463	CLIP-seq
MIRT1248788	hsa-miR-4494	CLIP-seq
MIRT1248789	hsa-miR-4535	CLIP-seq
MIRT1248790	hsa-miR-4638-3p	CLIP-seq
MIRT1248791	hsa-miR-4646-5p	CLIP-seq
MIRT1248792	hsa-miR-492	CLIP-seq
MIRT1248793	hsa-miR-502-5p	CLIP-seq
MIRT1248794	hsa-miR-532-5p	CLIP-seq
MIRT1248795	hsa-miR-571	CLIP-seq
MIRT1248771	hsa-miR-3161	CLIP-seq
MIRT1248773	hsa-miR-3654	CLIP-seq
MIRT1248775	hsa-miR-378	CLIP-seq
MIRT1248776	hsa-miR-378b	CLIP-seq
MIRT1248777	hsa-miR-378c	CLIP-seq
MIRT1248778	hsa-miR-378d	CLIP-seq
MIRT1248779	hsa-miR-378e	CLIP-seq
MIRT1248780	hsa-miR-378f	CLIP-seq
MIRT1248781	hsa-miR-378h	CLIP-seq
MIRT1248782	hsa-miR-378i	CLIP-seq
MIRT2073451	hsa-miR-384	CLIP-seq
MIRT1248783	hsa-miR-422a	CLIP-seq
MIRT1248787	hsa-miR-4463	CLIP-seq
MIRT1248788	hsa-miR-4494	CLIP-seq
MIRT2073452	hsa-miR-4504	CLIP-seq
MIRT1248789	hsa-miR-4535	CLIP-seq
MIRT1248790	hsa-miR-4638-3p	CLIP-seq
MIRT2073453	hsa-miR-4705	CLIP-seq
MIRT1248792	hsa-miR-492	CLIP-seq
MIRT2073454	hsa-miR-542-3p	CLIP-seq
MIRT2073455	hsa-miR-595	CLIP-seq
MIRT1248766	hsa-miR-1237	CLIP-seq
MIRT2597219	hsa-miR-1244	CLIP-seq
MIRT1248767	hsa-miR-1255a	CLIP-seq
MIRT1248768	hsa-miR-1255b	CLIP-seq
MIRT2597220	hsa-miR-1827	CLIP-seq
MIRT2597221	hsa-miR-199a-3p	CLIP-seq
MIRT2597222	hsa-miR-199b-3p	CLIP-seq
MIRT1248769	hsa-miR-219-1-3p	CLIP-seq
MIRT2597223	hsa-miR-2682	CLIP-seq
MIRT2597224	hsa-miR-29a	CLIP-seq
MIRT2597225	hsa-miR-29b	CLIP-seq
MIRT2597226	hsa-miR-29c	CLIP-seq
MIRT2597227	hsa-miR-3129-5p	CLIP-seq
MIRT2597228	hsa-miR-3150b-3p	CLIP-seq
MIRT1248770	hsa-miR-3152-5p	CLIP-seq
MIRT1248771	hsa-miR-3161	CLIP-seq
MIRT1248772	hsa-miR-3192	CLIP-seq
MIRT2597229	hsa-miR-3612	CLIP-seq
MIRT1248773	hsa-miR-3654	CLIP-seq
MIRT2597230	hsa-miR-3662	CLIP-seq
MIRT1248774	hsa-miR-3667-3p	CLIP-seq
MIRT1248775	hsa-miR-378	CLIP-seq
MIRT1248776	hsa-miR-378b	CLIP-seq
MIRT1248777	hsa-miR-378c	CLIP-seq
MIRT1248778	hsa-miR-378d	CLIP-seq
MIRT1248779	hsa-miR-378e	CLIP-seq
MIRT1248780	hsa-miR-378f	CLIP-seq
MIRT1248781	hsa-miR-378h	CLIP-seq
MIRT1248782	hsa-miR-378i	CLIP-seq
MIRT1248783	hsa-miR-422a	CLIP-seq
MIRT1248784	hsa-miR-4297	CLIP-seq
MIRT1248785	hsa-miR-4314	CLIP-seq
MIRT1248786	hsa-miR-4423-5p	CLIP-seq
MIRT1248787	hsa-miR-4463	CLIP-seq
MIRT1248788	hsa-miR-4494	CLIP-seq
MIRT2597231	hsa-miR-449c	CLIP-seq
MIRT2073452	hsa-miR-4504	CLIP-seq
MIRT1248789	hsa-miR-4535	CLIP-seq
MIRT1248790	hsa-miR-4638-3p	CLIP-seq
MIRT1248791	hsa-miR-4646-5p	CLIP-seq
MIRT2597232	hsa-miR-4689	CLIP-seq
MIRT2597233	hsa-miR-4695-5p	CLIP-seq
MIRT2597234	hsa-miR-4784	CLIP-seq
MIRT1248792	hsa-miR-492	CLIP-seq
MIRT1248793	hsa-miR-502-5p	CLIP-seq
MIRT1248794	hsa-miR-532-5p	CLIP-seq
MIRT2073454	hsa-miR-542-3p	CLIP-seq
MIRT1248795	hsa-miR-571	CLIP-seq
MIRT2073455	hsa-miR-595	CLIP-seq
MIRT2597235	hsa-miR-650	CLIP-seq
MIRT1248766	hsa-miR-1237	CLIP-seq
MIRT2597219	hsa-miR-1244	CLIP-seq
MIRT1248767	hsa-miR-1255a	CLIP-seq
MIRT1248768	hsa-miR-1255b	CLIP-seq
MIRT2597220	hsa-miR-1827	CLIP-seq
MIRT2597221	hsa-miR-199a-3p	CLIP-seq
MIRT2597222	hsa-miR-199b-3p	CLIP-seq
MIRT1248769	hsa-miR-219-1-3p	CLIP-seq
MIRT2597223	hsa-miR-2682	CLIP-seq
MIRT2597224	hsa-miR-29a	CLIP-seq
MIRT2597225	hsa-miR-29b	CLIP-seq
MIRT2597226	hsa-miR-29c	CLIP-seq
MIRT2597227	hsa-miR-3129-5p	CLIP-seq
MIRT2597228	hsa-miR-3150b-3p	CLIP-seq
MIRT1248770	hsa-miR-3152-5p	CLIP-seq
MIRT1248771	hsa-miR-3161	CLIP-seq
MIRT1248772	hsa-miR-3192	CLIP-seq
MIRT2597229	hsa-miR-3612	CLIP-seq
MIRT1248773	hsa-miR-3654	CLIP-seq
MIRT2597230	hsa-miR-3662	CLIP-seq
MIRT1248774	hsa-miR-3667-3p	CLIP-seq
MIRT1248775	hsa-miR-378	CLIP-seq
MIRT1248776	hsa-miR-378b	CLIP-seq
MIRT1248777	hsa-miR-378c	CLIP-seq
MIRT1248778	hsa-miR-378d	CLIP-seq
MIRT1248779	hsa-miR-378e	CLIP-seq
MIRT1248780	hsa-miR-378f	CLIP-seq
MIRT1248781	hsa-miR-378h	CLIP-seq
MIRT1248782	hsa-miR-378i	CLIP-seq
MIRT1248783	hsa-miR-422a	CLIP-seq
MIRT1248784	hsa-miR-4297	CLIP-seq
MIRT1248785	hsa-miR-4314	CLIP-seq
MIRT1248786	hsa-miR-4423-5p	CLIP-seq
MIRT1248787	hsa-miR-4463	CLIP-seq
MIRT1248788	hsa-miR-4494	CLIP-seq
MIRT2597231	hsa-miR-449c	CLIP-seq
MIRT1248789	hsa-miR-4535	CLIP-seq
MIRT1248790	hsa-miR-4638-3p	CLIP-seq
MIRT1248791	hsa-miR-4646-5p	CLIP-seq
MIRT2597232	hsa-miR-4689	CLIP-seq
MIRT2597233	hsa-miR-4695-5p	CLIP-seq
MIRT2597234	hsa-miR-4784	CLIP-seq
MIRT1248792	hsa-miR-492	CLIP-seq
MIRT1248793	hsa-miR-502-5p	CLIP-seq
MIRT1248794	hsa-miR-532-5p	CLIP-seq
MIRT1248795	hsa-miR-571	CLIP-seq
MIRT2597235	hsa-miR-650	CLIP-seq

Gene ontology (GO) Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000428	Component	DNA-directed RNA polymerase complex	IEA
GO:0000932	Component	P-body	IBA
GO:0000956	Process	Nuclear-transcribed mRNA catabolic process	IBA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003697	Function	Single-stranded DNA binding	IBA
GO:0003723	Function	RNA binding	IEA
GO:0003727	Function	Single-stranded RNA binding	IBA
GO:0005515	Function	Protein binding	IPI	9528765, 28514442, 32296183
GO:0005634	Component	Nucleus	IDA	9852112
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005665	Component	RNA polymerase II, core complex	IBA
GO:0005665	Component	RNA polymerase II, core complex	IDA	9852112
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006352	Process	DNA-templated transcription initiation	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IDA	9852112
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	IBA
GO:0031369	Function	Translation initiation factor binding	IBA
GO:0045948	Process	Positive regulation of translational initiation	IBA
GO:0060213	Process	Positive regulation of nuclear-transcribed mRNA poly(A) tail shortening	IBA

Other IDs

• MIM: 602013
• HGNC: 9194
• e!Ensembl: ENSG00000168002

Protein

• UniProt ID: P62487
• Protein name: DNA-directed RNA polymerase II subunit RPB7 (RNA polymerase II subunit B7) (DNA-directed RNA polymerase II subunit G) (RNA polymerase II 19 kDa subunit) (RPB19)
• Protein function: Core component of RNA polymerase II (Pol II), a DNA-dependent RNA polymerase which synthesizes mRNA precursors and many functional non-coding RNAs using the four ribonucleoside triphosphates as substrates. Pol II is the central component of the
• PDB: 2C35 , 5IY6 , 5IY7 , 5IY8 , 5IY9 , 5IYA , 5IYB , 5IYC , 5IYD , 6DRD , 6O9L , 6XRE , 7LBM , 9EHZ , 9EI1 , 9EI3 , 9EI4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00575	S1	78 → 161	S1 RNA binding domain	Domain
  PF03876	SHS2_Rpb7-N	8 → 64	SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397	Domain

• Sequence:

  MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
  PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
  PNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS

• Sequence length: 172

Pathways

KEGG Pathway	Reactome Pathway
RNA polymerase	Formation of RNA Pol II elongation complex
Nucleotide excision repair	Formation of the Early Elongation Complex
Huntington disease	Formation of HIV-1 elongation complex containing HIV-1 Tat
	Viral Messenger RNA Synthesis
	MicroRNA (miRNA) biogenesis
	Transcriptional regulation by small RNAs
	RNA Polymerase II Pre-transcription Events
	Formation of TC-NER Pre-Incision Complex
	Transcription-Coupled Nucleotide Excision Repair (TC-NER)
	Dual incision in TC-NER
	Gap-filling DNA repair synthesis and ligation in TC-NER
	TP53 Regulates Transcription of DNA Repair Genes
	FGFR2 alternative splicing
	RNA polymerase II transcribes snRNA genes
	mRNA Capping
	mRNA Splicing - Major Pathway
	mRNA Splicing - Minor Pathway
	Processing of Capped Intron-Containing Pre-mRNA
	RNA Polymerase II Promoter Escape
	RNA Polymerase II Transcription Pre-Initiation And Promoter Opening
	RNA Polymerase II Transcription Initiation
	RNA Polymerase II Transcription Elongation
	RNA Polymerase II Transcription Initiation And Promoter Clearance
	RNA Pol II CTD phosphorylation and interaction with CE
	Estrogen-dependent gene expression

Related Genes

Sort by: Blended Diseases Pathways Evidence source

POLR2A 27 shared pathwaysRNA polymerase, Nucleotide excision repair, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway, mRNA Splicing - Minor Pathway +15 more Related via 27 shared pathways including RNA polymerase, Nucleotide excision repair. POLR2B 27 shared pathwaysRNA polymerase, Nucleotide excision repair, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway, mRNA Splicing - Minor Pathway +15 more Related via 27 shared pathways including RNA polymerase, Nucleotide excision repair. POLR2C 27 shared pathwaysRNA polymerase, Nucleotide excision repair, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway, mRNA Splicing - Minor Pathway +15 more Related via 27 shared pathways including RNA polymerase, Nucleotide excision repair. POLR2D 27 shared pathwaysRNA polymerase, Nucleotide excision repair, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway, mRNA Splicing - Minor Pathway +15 more Related via 27 shared pathways including RNA polymerase, Nucleotide excision repair. POLR2I 27 shared pathwaysRNA polymerase, Nucleotide excision repair, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway, mRNA Splicing - Minor Pathway +15 more Related via 27 shared pathways including RNA polymerase, Nucleotide excision repair.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
POLR2A	0	[]	27	["RNA polymerase","Nucleotide excision repair","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway","mRNA Splicing - Minor Pathway"]	0	[]
POLR2B	0	[]	27	["RNA polymerase","Nucleotide excision repair","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway","mRNA Splicing - Minor Pathway"]	0	[]
POLR2C	0	[]	27	["RNA polymerase","Nucleotide excision repair","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway","mRNA Splicing - Minor Pathway"]	0	[]
POLR2D	0	[]	27	["RNA polymerase","Nucleotide excision repair","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway","mRNA Splicing - Minor Pathway"]	0	[]
POLR2I	0	[]	27	["RNA polymerase","Nucleotide excision repair","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway","mRNA Splicing - Minor Pathway"]	0	[]

Diseases Linked via Similar Genes

Atrial fibrillation Linked via 1 of 5 related genesPOLR2A Cardioembolic stroke Linked via 1 of 5 related genesPOLR2A Central nervous system cancer Linked via 1 of 5 related genesPOLR2A Developmental disability Linked via 1 of 5 related genesPOLR2A Endometriosis Linked via 1 of 5 related genesPOLR2A

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Atrial fibrillation	1	["POLR2A"]
Cardioembolic stroke	1	["POLR2A"]
Central nervous system cancer	1	["POLR2A"]
Developmental disability	1	["POLR2A"]
Endometriosis	1	["POLR2A"]