POLR2I (RNA polymerase II subunit I)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 5438
• Gene name: RNA polymerase II subunit I
• Gene symbol: POLR2I
• Synonyms (NCBI Gene): RPB9, hRPB14.5
• Chromosome: 19
• Chromosome location: 19q13.12
• Summary: This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit, in combination with two other polymerase subunits, forms the DNA binding domain of the polymerase, a groove in which t

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023875	hsa-miR-1-3p	Proteomics	18668040
MIRT049323	hsa-miR-92a-3p	CLASH	23622248
MIRT043800	hsa-miR-328-3p	CLASH	23622248
MIRT035955	hsa-miR-1180-3p	CLASH	23622248
MIRT035845	hsa-miR-1268a	CLASH	23622248

Gene ontology (GO) Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000428	Component	DNA-directed RNA polymerase complex	IEA
GO:0001193	Process	Maintenance of transcriptional fidelity during transcription elongation by RNA polymerase II	IBA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003899	Function	DNA-directed RNA polymerase activity	IBA
GO:0003899	Function	DNA-directed RNA polymerase activity	IEA
GO:0003899	Function	DNA-directed RNA polymerase activity	TAS	8265347
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005634	Component	Nucleus	IDA	9852112
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005665	Component	RNA polymerase II, core complex	IBA
GO:0005665	Component	RNA polymerase II, core complex	IDA	9852112
GO:0005730	Component	Nucleolus	IEA
GO:0006283	Process	Transcription-coupled nucleotide-excision repair	IBA
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IDA	9852112
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	TAS	8265347
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 180662
• HGNC: 9196
• e!Ensembl: ENSG00000105258

Protein

• UniProt ID: P36954
• Protein name: DNA-directed RNA polymerase II subunit RPB9 (RNA polymerase II subunit B9) (DNA-directed RNA polymerase II subunit I) (RNA polymerase II 14.5 kDa subunit) (RPB14.5)
• Protein function: Core component of RNA polymerase II (Pol II), a DNA-dependent RNA polymerase which synthesizes mRNA precursors and many functional non-coding RNAs using the four ribonucleoside triphosphates as substrates. Pol II is the central component of the
• PDB: 5IY6 , 5IY7 , 5IY8 , 5IY9 , 5IYA , 5IYB , 5IYC , 5IYD , 6DRD , 6O9L , 6XRE , 7LBM , 9EHZ , 9EI1 , 9EI3 , 9EI4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01096	TFIIS_C	84 → 124	Transcription factor S-II (TFIIS)	Domain
  PF02150	RNA_POL_M_15KD	14 → 51	RNA polymerases M/15 Kd subunit	Domain

• Sequence:

  MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
  EVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCG
  HRWTE

• Sequence length: 125

Pathways

KEGG Pathway	Reactome Pathway
RNA polymerase	Formation of RNA Pol II elongation complex
Nucleotide excision repair	Formation of the Early Elongation Complex
Huntington disease	Formation of HIV-1 elongation complex containing HIV-1 Tat
	Viral Messenger RNA Synthesis
	MicroRNA (miRNA) biogenesis
	Transcriptional regulation by small RNAs
	RNA Polymerase II Pre-transcription Events
	Formation of TC-NER Pre-Incision Complex
	Transcription-Coupled Nucleotide Excision Repair (TC-NER)
	Dual incision in TC-NER
	Gap-filling DNA repair synthesis and ligation in TC-NER
	TP53 Regulates Transcription of DNA Repair Genes
	FGFR2 alternative splicing
	RNA polymerase II transcribes snRNA genes
	mRNA Capping
	mRNA Splicing - Major Pathway
	mRNA Splicing - Minor Pathway
	Processing of Capped Intron-Containing Pre-mRNA
	RNA Polymerase II Promoter Escape
	RNA Polymerase II Transcription Pre-Initiation And Promoter Opening
	RNA Polymerase II Transcription Initiation
	RNA Polymerase II Transcription Elongation
	RNA Polymerase II Transcription Initiation And Promoter Clearance
	RNA Pol II CTD phosphorylation and interaction with CE
	Estrogen-dependent gene expression

Related Genes

Sort by: Blended Diseases Pathways Evidence source

POLR2A 27 shared pathwaysRNA polymerase, Nucleotide excision repair, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway, mRNA Splicing - Minor Pathway +15 more Related via 27 shared pathways including RNA polymerase, Nucleotide excision repair. POLR2B 27 shared pathwaysRNA polymerase, Nucleotide excision repair, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway, mRNA Splicing - Minor Pathway +15 more Related via 27 shared pathways including RNA polymerase, Nucleotide excision repair. POLR2C 27 shared pathwaysRNA polymerase, Nucleotide excision repair, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway, mRNA Splicing - Minor Pathway +15 more Related via 27 shared pathways including RNA polymerase, Nucleotide excision repair. POLR2D 27 shared pathwaysRNA polymerase, Nucleotide excision repair, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway, mRNA Splicing - Minor Pathway +15 more Related via 27 shared pathways including RNA polymerase, Nucleotide excision repair. POLR2G 27 shared pathwaysRNA polymerase, Nucleotide excision repair, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway, mRNA Splicing - Minor Pathway +15 more Related via 27 shared pathways including RNA polymerase, Nucleotide excision repair.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
POLR2A	0	[]	27	["RNA polymerase","Nucleotide excision repair","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway","mRNA Splicing - Minor Pathway"]	0	[]
POLR2B	0	[]	27	["RNA polymerase","Nucleotide excision repair","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway","mRNA Splicing - Minor Pathway"]	0	[]
POLR2C	0	[]	27	["RNA polymerase","Nucleotide excision repair","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway","mRNA Splicing - Minor Pathway"]	0	[]
POLR2D	0	[]	27	["RNA polymerase","Nucleotide excision repair","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway","mRNA Splicing - Minor Pathway"]	0	[]
POLR2G	0	[]	27	["RNA polymerase","Nucleotide excision repair","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway","mRNA Splicing - Minor Pathway"]	0	[]

Diseases Linked via Similar Genes

Atrial fibrillation Linked via 1 of 5 related genesPOLR2A Cardioembolic stroke Linked via 1 of 5 related genesPOLR2A Central nervous system cancer Linked via 1 of 5 related genesPOLR2A Developmental disability Linked via 1 of 5 related genesPOLR2A Endometriosis Linked via 1 of 5 related genesPOLR2A

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Atrial fibrillation	1	["POLR2A"]
Cardioembolic stroke	1	["POLR2A"]
Central nervous system cancer	1	["POLR2A"]
Developmental disability	1	["POLR2A"]
Endometriosis	1	["POLR2A"]