POLD4 (DNA polymerase delta 4, accessory subunit)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 57804
• Gene name: DNA polymerase delta 4, accessory subunit
• Gene symbol: POLD4
• Synonyms (NCBI Gene): POLDS, p12
• Chromosome: 11
• Chromosome location: 11q13.2
• Summary: This gene encodes the smallest subunit of DNA polymerase delta. DNA polymerase delta possesses both polymerase and 3` to 5` exonuclease activity and plays a critical role in DNA replication and repair. The encoded protein enhances the activity of DNA poly

miRNA Show/Hide all (93)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017868	hsa-miR-335-5p	Microarray	18185580
MIRT029515	hsa-miR-26b-5p	Microarray	19088304
MIRT735342	hsa-miR-1293	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, qRT-PCR, In situ hybridization	32320642
MIRT1247330	hsa-miR-4480	CLIP-seq
MIRT1247331	hsa-miR-4722-3p	CLIP-seq
MIRT1247332	hsa-miR-4727-5p	CLIP-seq
MIRT1247333	hsa-miR-4763-5p	CLIP-seq
MIRT2072921	hsa-miR-1200	CLIP-seq
MIRT2072922	hsa-miR-3155	CLIP-seq
MIRT2072923	hsa-miR-3155b	CLIP-seq
MIRT2072924	hsa-miR-3160-3p	CLIP-seq
MIRT2072925	hsa-miR-3182	CLIP-seq
MIRT2072926	hsa-miR-3192	CLIP-seq
MIRT2072927	hsa-miR-370	CLIP-seq
MIRT2072928	hsa-miR-3908	CLIP-seq
MIRT2072929	hsa-miR-4300	CLIP-seq
MIRT2072930	hsa-miR-4324	CLIP-seq
MIRT2072931	hsa-miR-4326	CLIP-seq
MIRT2072932	hsa-miR-4437	CLIP-seq
MIRT2072933	hsa-miR-4468	CLIP-seq
MIRT1247330	hsa-miR-4480	CLIP-seq
MIRT2072934	hsa-miR-4487	CLIP-seq
MIRT2072935	hsa-miR-4656	CLIP-seq
MIRT2072936	hsa-miR-4663	CLIP-seq
MIRT2072937	hsa-miR-4674	CLIP-seq
MIRT2072938	hsa-miR-4691-5p	CLIP-seq
MIRT1247331	hsa-miR-4722-3p	CLIP-seq
MIRT2072939	hsa-miR-4722-5p	CLIP-seq
MIRT1247332	hsa-miR-4727-5p	CLIP-seq
MIRT1247333	hsa-miR-4763-5p	CLIP-seq
MIRT2072940	hsa-miR-484	CLIP-seq
MIRT2072941	hsa-miR-544b	CLIP-seq
MIRT2072942	hsa-miR-558	CLIP-seq
MIRT2072943	hsa-miR-720	CLIP-seq
MIRT2072944	hsa-miR-920	CLIP-seq
MIRT2072921	hsa-miR-1200	CLIP-seq
MIRT2596861	hsa-miR-1262	CLIP-seq
MIRT2072924	hsa-miR-3160-3p	CLIP-seq
MIRT2072925	hsa-miR-3182	CLIP-seq
MIRT2072928	hsa-miR-3908	CLIP-seq
MIRT2072930	hsa-miR-4324	CLIP-seq
MIRT2072931	hsa-miR-4326	CLIP-seq
MIRT2596862	hsa-miR-4436b-3p	CLIP-seq
MIRT2072932	hsa-miR-4437	CLIP-seq
MIRT2072933	hsa-miR-4468	CLIP-seq
MIRT1247330	hsa-miR-4480	CLIP-seq
MIRT2596863	hsa-miR-4483	CLIP-seq
MIRT2072934	hsa-miR-4487	CLIP-seq
MIRT2596864	hsa-miR-451b	CLIP-seq
MIRT2072935	hsa-miR-4656	CLIP-seq
MIRT2072936	hsa-miR-4663	CLIP-seq
MIRT2072937	hsa-miR-4674	CLIP-seq
MIRT2072938	hsa-miR-4691-5p	CLIP-seq
MIRT2596865	hsa-miR-4701-3p	CLIP-seq
MIRT2596866	hsa-miR-4710	CLIP-seq
MIRT1247331	hsa-miR-4722-3p	CLIP-seq
MIRT2072939	hsa-miR-4722-5p	CLIP-seq
MIRT1247332	hsa-miR-4727-5p	CLIP-seq
MIRT1247333	hsa-miR-4763-5p	CLIP-seq
MIRT2596867	hsa-miR-4792	CLIP-seq
MIRT2072941	hsa-miR-544b	CLIP-seq
MIRT2072942	hsa-miR-558	CLIP-seq
MIRT2596868	hsa-miR-610	CLIP-seq
MIRT2596869	hsa-miR-635	CLIP-seq
MIRT2072943	hsa-miR-720	CLIP-seq
MIRT2072921	hsa-miR-1200	CLIP-seq
MIRT2596861	hsa-miR-1262	CLIP-seq
MIRT2072924	hsa-miR-3160-3p	CLIP-seq
MIRT2072925	hsa-miR-3182	CLIP-seq
MIRT2072928	hsa-miR-3908	CLIP-seq
MIRT2072930	hsa-miR-4324	CLIP-seq
MIRT2072931	hsa-miR-4326	CLIP-seq
MIRT2072932	hsa-miR-4437	CLIP-seq
MIRT2072933	hsa-miR-4468	CLIP-seq
MIRT1247330	hsa-miR-4480	CLIP-seq
MIRT2596863	hsa-miR-4483	CLIP-seq
MIRT2072934	hsa-miR-4487	CLIP-seq
MIRT2596864	hsa-miR-451b	CLIP-seq
MIRT2072935	hsa-miR-4656	CLIP-seq
MIRT2072936	hsa-miR-4663	CLIP-seq
MIRT2072937	hsa-miR-4674	CLIP-seq
MIRT2072938	hsa-miR-4691-5p	CLIP-seq
MIRT2596865	hsa-miR-4701-3p	CLIP-seq
MIRT2596866	hsa-miR-4710	CLIP-seq
MIRT1247331	hsa-miR-4722-3p	CLIP-seq
MIRT2072939	hsa-miR-4722-5p	CLIP-seq
MIRT1247332	hsa-miR-4727-5p	CLIP-seq
MIRT1247333	hsa-miR-4763-5p	CLIP-seq
MIRT2596867	hsa-miR-4792	CLIP-seq
MIRT2072941	hsa-miR-544b	CLIP-seq
MIRT2072942	hsa-miR-558	CLIP-seq
MIRT2596869	hsa-miR-635	CLIP-seq
MIRT2072943	hsa-miR-720	CLIP-seq

Gene ontology (GO) Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000731	Process	DNA synthesis involved in DNA repair	IBA
GO:0000731	Process	DNA synthesis involved in DNA repair	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IEA
GO:0003887	Function	DNA-directed DNA polymerase activity	IBA
GO:0005515	Function	Protein binding	IPI	12403614, 15670210, 16510448, 26496610, 28514442, 31449058, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006260	Process	DNA replication	IEA
GO:0006261	Process	DNA-templated DNA replication	IBA
GO:0006261	Process	DNA-templated DNA replication	IDA	20334433
GO:0006261	Process	DNA-templated DNA replication	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0043625	Component	Delta DNA polymerase complex	IBA
GO:0043625	Component	Delta DNA polymerase complex	IPI	12403614

Other IDs

• MIM: 611525
• HGNC: 14106
• e!Ensembl: ENSG00000175482

Protein

• UniProt ID: Q9HCU8
• Protein name: DNA polymerase delta subunit 4 (DNA polymerase delta subunit p12)
• Protein function: As a component of the tetrameric DNA polymerase delta complex (Pol-delta4), plays a role in high fidelity genome replication and repair. Within this complex, increases the rate of DNA synthesis and decreases fidelity by regulating POLD1 polymera
• PDB: 6HVO , 6S1M , 6S1N , 6S1O , 6TNY , 6TNZ , 9EKB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04081	DNA_pol_delta_4	26 → 97	DNA polymerase delta, subunit 4	Family

• Sequence:

  MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGP
  CTGITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL

• Sequence length: 107

Pathways

KEGG Pathway	Reactome Pathway
DNA replication	Recognition of DNA damage by PCNA-containing replication complex
Base excision repair	Polymerase switching on the C-strand of the telomere
Nucleotide excision repair	Processive synthesis on the C-strand of the telomere
Mismatch repair	Telomere C-strand (Lagging Strand) Synthesis
Homologous recombination	Removal of the Flap Intermediate from the C-strand
	Mismatch repair (MMR) directed by MSH2:MSH6 (MutSalpha)
	Mismatch repair (MMR) directed by MSH2:MSH3 (MutSbeta)
	PCNA-Dependent Long Patch Base Excision Repair
	Termination of translesion DNA synthesis
	HDR through Homologous Recombination (HRR)
	Gap-filling DNA repair synthesis and ligation in GG-NER
	Dual Incision in GG-NER
	Dual incision in TC-NER
	Gap-filling DNA repair synthesis and ligation in TC-NER
	Polymerase switching
	Removal of the Flap Intermediate
	Processive synthesis on the lagging strand

Related Genes

Sort by: Blended Diseases Pathways Evidence source

POLD3 22 shared pathwaysDNA replication, Base excision repair, Nucleotide excision repair, Mismatch repair, Homologous recombination, Dual Incision in GG-NER, Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, HDR through Homologous Recombination (HRR), Recognition of DNA damage by PCNA-containing replication complex, Polymerase switching on the C-strand of the telomere, Processive synthesis on the C-strand of the telomere +10 more Related via 22 shared pathways including DNA replication, Base excision repair. POLD1 22 shared pathwaysDNA replication, Base excision repair, Nucleotide excision repair, Mismatch repair, Homologous recombination, Dual Incision in GG-NER, Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, HDR through Homologous Recombination (HRR), Recognition of DNA damage by PCNA-containing replication complex, Polymerase switching on the C-strand of the telomere, Processive synthesis on the C-strand of the telomere +10 more Related via 22 shared pathways including DNA replication, Base excision repair. POLD2 22 shared pathwaysDNA replication, Base excision repair, Nucleotide excision repair, Mismatch repair, Homologous recombination, Dual Incision in GG-NER, Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, HDR through Homologous Recombination (HRR), Recognition of DNA damage by PCNA-containing replication complex, Polymerase switching on the C-strand of the telomere, Processive synthesis on the C-strand of the telomere +10 more Related via 22 shared pathways including DNA replication, Base excision repair. PCNA 20 shared pathwaysDNA replication, Base excision repair, Nucleotide excision repair, Mismatch repair, Dual Incision in GG-NER, Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, HDR through Homologous Recombination (HRR), Recognition of DNA damage by PCNA-containing replication complex, Polymerase switching on the C-strand of the telomere, Processive synthesis on the C-strand of the telomere, Telomere C-strand (Lagging Strand) Synthesis +8 more Related via 20 shared pathways including DNA replication, Base excision repair. RFC1 14 shared pathwaysDNA replication, Base excision repair, Nucleotide excision repair, Mismatch repair, Dual Incision in GG-NER, Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, HDR through Homologous Recombination (HRR), Recognition of DNA damage by PCNA-containing replication complex, Polymerase switching on the C-strand of the telomere, PCNA-Dependent Long Patch Base Excision Repair, Termination of translesion DNA synthesis +2 more Related via 14 shared pathways including DNA replication, Base excision repair.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
POLD3	0	[]	22	["DNA replication","Base excision repair","Nucleotide excision repair","Mismatch repair","Homologous recombination","Dual Incision in GG-NER","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","HDR through Homologous Recombination (HRR)","Recognition of DNA damage by PCNA-containing replication complex","Polymerase switching on the C-strand of the telomere","Processive synthesis on the C-strand of the telomere"]	0	[]
POLD1	0	[]	22	["DNA replication","Base excision repair","Nucleotide excision repair","Mismatch repair","Homologous recombination","Dual Incision in GG-NER","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","HDR through Homologous Recombination (HRR)","Recognition of DNA damage by PCNA-containing replication complex","Polymerase switching on the C-strand of the telomere","Processive synthesis on the C-strand of the telomere"]	0	[]
POLD2	0	[]	22	["DNA replication","Base excision repair","Nucleotide excision repair","Mismatch repair","Homologous recombination","Dual Incision in GG-NER","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","HDR through Homologous Recombination (HRR)","Recognition of DNA damage by PCNA-containing replication complex","Polymerase switching on the C-strand of the telomere","Processive synthesis on the C-strand of the telomere"]	0	[]
PCNA	0	[]	20	["DNA replication","Base excision repair","Nucleotide excision repair","Mismatch repair","Dual Incision in GG-NER","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","HDR through Homologous Recombination (HRR)","Recognition of DNA damage by PCNA-containing replication complex","Polymerase switching on the C-strand of the telomere","Processive synthesis on the C-strand of the telomere","Telomere C-strand (Lagging Strand) Synthesis"]	0	[]
RFC1	0	[]	14	["DNA replication","Base excision repair","Nucleotide excision repair","Mismatch repair","Dual Incision in GG-NER","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","HDR through Homologous Recombination (HRR)","Recognition of DNA damage by PCNA-containing replication complex","Polymerase switching on the C-strand of the telomere","PCNA-Dependent Long Patch Base Excision Repair","Termination of translesion DNA synthesis"]	0	[]

Diseases Linked via Similar Genes

Atrial fibrillation Linked via 2 of 5 related genesPOLD3, POLD1 Colorectal cancer Linked via 2 of 5 related genesPOLD3, POLD1 Colorectal neoplasms Linked via 2 of 5 related genesPOLD3, POLD1 Immunodeficiency Linked via 2 of 5 related genesPOLD3, POLD1 non-severe combined immunodeficiency due to polymerase delta deficiency Linked via 2 of 5 related genesPOLD1, POLD2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Atrial fibrillation	2	["POLD3","POLD1"]
Colorectal cancer	2	["POLD3","POLD1"]
Colorectal neoplasms	2	["POLD3","POLD1"]
Immunodeficiency	2	["POLD3","POLD1"]
non-severe combined immunodeficiency due to polymerase delta deficiency	2	["POLD1","POLD2"]