PLA1A (phospholipase A1 member A)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 51365
• Gene name: Phospholipase A1 member A
• Gene symbol: PLA1A
• Synonyms (NCBI Gene): PS-PLA1, PSPLA1
• Chromosome: 3
• Chromosome location: 3q13.33
• Summary: The protein encoded by this gene is a phospholipase that hydrolyzes fatty acids at the sn-1 position of phosphatidylserine and 1-acyl-2-lysophosphatidylserine. This secreted protein hydrolyzes phosphatidylserine in liposomes. Three transcript variants enc

miRNA Show/Hide all (14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1238350	hsa-miR-1470	CLIP-seq
MIRT1238351	hsa-miR-3607-3p	CLIP-seq
MIRT1238352	hsa-miR-3662	CLIP-seq
MIRT1238353	hsa-miR-3686	CLIP-seq
MIRT1238354	hsa-miR-4287	CLIP-seq
MIRT1238355	hsa-miR-4469	CLIP-seq
MIRT1238356	hsa-miR-4667-3p	CLIP-seq
MIRT1238357	hsa-miR-4685-3p	CLIP-seq
MIRT1238358	hsa-miR-4713-5p	CLIP-seq
MIRT1238352	hsa-miR-3662	CLIP-seq
MIRT2456585	hsa-miR-519a	CLIP-seq
MIRT2456586	hsa-miR-519b-3p	CLIP-seq
MIRT2456587	hsa-miR-519c-3p	CLIP-seq
MIRT2456588	hsa-miR-586	CLIP-seq

Gene ontology (GO) Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002080	Component	Acrosomal membrane	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	TAS	10196188
GO:0006658	Process	Phosphatidylserine metabolic process	TAS	10196188
GO:0008970	Function	Phospholipase A1 activity	IBA
GO:0008970	Function	Phospholipase A1 activity	IEA
GO:0008970	Function	Phospholipase A1 activity	TAS	10196188
GO:0016042	Process	Lipid catabolic process	IBA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016298	Function	Lipase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0036150	Process	Phosphatidylserine acyl-chain remodeling	TAS
GO:0052689	Function	Carboxylic ester hydrolase activity	IEA

Other IDs

• MIM: 607460
• HGNC: 17661
• e!Ensembl: ENSG00000144837

Protein

• UniProt ID: Q53H76
• Protein name: Phospholipase A1 member A (EC 3.1.1.111) (Phosphatidylserine-specific phospholipase A1) (PS-PLA1)
• Protein function: Hydrolyzes the ester bond of the acyl group attached at the sn-1 position of phosphatidylserines (phospholipase A1 activity) and 1-acyl-2-lysophosphatidylserines (lysophospholipase activity) in the pathway of phosphatidylserines acyl chain remod
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00151	Lipase	15 → 336	Lipase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. Expressed in placenta, prostate and liver. Weakly or not expressed in skin, leukocytes, platelets, colon, spleen, lung, muscle and kidney. {ECO:0000269|PubMed:9074642}.
• Sequence:

  MPPGPWESCFWVGGLILWLSVGSSGDAPPTPQPKCADFQSANLFEGTDLKVQFLLFVPSN
  PSCGQLVEGSSDLQNSGFNATLGTKLIIHGFRVLGTKPSWIDTFIRTLLRATNANVIAVD
  WIYGSTGVYFSAVKNVIKLSLEISLFLNKLLVLGVSESSIHIIGVSLGAHVGGMVGQLFG
  GQLGQITGLDPAGPEYTRASVEERLDAGDALFVEAIHTDTDNLGIRIPVGHVDYFVNGGQ
  DQPGCPTFFYAGYSYLICDHMRAVHLYISALENSCPLMAFPCASYKAFLAGRCLDCFNPF
  LLSCPRIGLVEQGGVKIEPLPKEVKVYLLTTSSAPYCMHHSLVEFHLKELRNKDTNIEVT
  FLSSNITSSSKITIPKQQRYGKGIIAHATPQCQINQVKFKFQSSNRVWKKDRTTIIGKFC
  TALLPVNDREKMVCLPEPVNLQASVTVSCDLKIACV

• Sequence length: 456

Pathways

KEGG Pathway	Reactome Pathway
Glycerophospholipid metabolism	Acyl chain remodelling of PS
Ras signaling pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (29)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	28948974		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28948974		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	31131562		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32060356	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	28143894		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	30849106		★☆☆☆☆ Found in Text Mining only
Elliptocytosis, Hereditary	Elliptocytosis	BEFREE	21839655		★☆☆☆☆ Found in Text Mining only
Familial primary pulmonary hypertension	Pulmonary Hypertension	BEFREE	24224048		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	23376982, 30992545		★☆☆☆☆ Found in Text Mining only
Junctional Epidermolysis Bullosa	Junctional Epidermolysis Bullosa	BEFREE	11952829		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26759305		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28143894		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	32060356	Stimulate	★☆☆☆☆ Found in Text Mining only
Lobstein Disease	Lobstein Disease	BEFREE	10686420		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28143894		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20179151, 23500037, 30992545		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29500864		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33723350	Associate	★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	30849106		★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	9883726		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	25604253, 27745838		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	10531147		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18427545, 20179151		★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	22526018		★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Osteogenesis Imperfecta	BEFREE	25146735		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	30849106		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28948974		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	26656492, 28634652		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28143894		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

MBOAT1 2 shared pathwaysGlycerophospholipid metabolism, Acyl chain remodelling of PS Related via 2 shared pathways including Glycerophospholipid metabolism, Acyl chain remodelling of PS. LPCAT3 2 shared pathwaysGlycerophospholipid metabolism, Acyl chain remodelling of PS Related via 2 shared pathways including Glycerophospholipid metabolism, Acyl chain remodelling of PS. PLAAT3 3 shared pathwaysGlycerophospholipid metabolism, Ras signaling pathway, Acyl chain remodelling of PS Related via 3 shared pathways including Glycerophospholipid metabolism, Ras signaling pathway. LPCAT4 2 shared pathwaysGlycerophospholipid metabolism, Acyl chain remodelling of PS Related via 2 shared pathways including Glycerophospholipid metabolism, Acyl chain remodelling of PS. PLAAT2 2 shared pathwaysGlycerophospholipid metabolism, Ras signaling pathway Related via 2 shared pathways including Glycerophospholipid metabolism, Ras signaling pathway.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
MBOAT1	0	[]	2	["Glycerophospholipid metabolism","Acyl chain remodelling of PS"]	0	[]
LPCAT3	0	[]	2	["Glycerophospholipid metabolism","Acyl chain remodelling of PS"]	0	[]
PLAAT3	0	[]	3	["Glycerophospholipid metabolism","Ras signaling pathway","Acyl chain remodelling of PS"]	0	[]
LPCAT4	0	[]	2	["Glycerophospholipid metabolism","Acyl chain remodelling of PS"]	0	[]
PLAAT2	0	[]	2	["Glycerophospholipid metabolism","Ras signaling pathway"]	0	[]

Diseases Linked via Similar Genes

Cholelithiasis Linked via 1 of 5 related genesMBOAT1 Iron metabolism disorder Linked via 1 of 5 related genesMBOAT1 Metabolic syndrome Linked via 1 of 5 related genesMBOAT1 Myocardial infarction Linked via 1 of 5 related genesMBOAT1 Obesity Linked via 1 of 5 related genesMBOAT1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Cholelithiasis	1	["MBOAT1"]
Iron metabolism disorder	1	["MBOAT1"]
Metabolic syndrome	1	["MBOAT1"]
Myocardial infarction	1	["MBOAT1"]
Obesity	1	["MBOAT1"]