PFN4 (profilin family member 4)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 375189
Gene name Profilin family member 4
Gene symbol PFN4
Synonyms (NCBI Gene)
-
Chromosome 2
Chromosome location 2p23.3
miRNA miRNA information provided by mirtarbase database.
14 Show/Hide all (14)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT450137 hsa-miR-4280 PAR-CLIP 22100165
MIRT450136 hsa-miR-6733-3p PAR-CLIP 22100165
MIRT450134 hsa-miR-4302 PAR-CLIP 22100165
MIRT450135 hsa-miR-4635 PAR-CLIP 22100165
MIRT450133 hsa-miR-4697-3p PAR-CLIP 22100165
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16 Show/Hide all (16)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001675 Process Acrosome assembly IEA
GO:0001675 Process Acrosome assembly ISS
GO:0003779 Function Actin binding IEA
GO:0003785 Function Actin monomer binding IBA
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
620046 31103 ENSG00000176732
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NHR9
Protein name Profilin-4 (Profilin IV)
Protein function Involved in male fertility. Required for manchette development and acrosome biogenesis during spermiogenesis (By similarity). Binds in vitro to phospholipids, including phosphatidylinositol 3-phosphate (PtdIns(3)P), phosphatidylinositol 4,5-bisp
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00235 Profilin 2 → 129 Profilin Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in testis, in germ cells in seminiferous tubules (at protein level) (PubMed:15591451, PubMed:19419568). Prominently expressed in pachytene/diplotene stage spematocytes (PubMed:33438010). {ECO:0000269|PubMed:15591451, ECO:0000
Sequence 
MSHLQSLLLDTLLGTKHVDSAALIKIQERSLCVASPGFNVTPSDVRTLVNGFAKNPLQAR
REGLYFKGKDYRCVRADEYSLYAKNENTGVVVVKTHLYLLVATYTEGMYPSICVEATESL
GDYLRKKGS
Sequence length 129
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Amyotrophic lateral sclerosis
Shigellosis
Salmonella infection
Sort by:
PFN3 4 shared pathwaysRap1 signaling pathway, Regulation of actin cytoskeleton, Shigellosis, Salmonella infection Related via 4 shared pathways including Rap1 signaling pathway, Regulation of actin cytoskeleton. PFN2 4 shared pathwaysRap1 signaling pathway, Regulation of actin cytoskeleton, Shigellosis, Salmonella infection Related via 4 shared pathways including Rap1 signaling pathway, Regulation of actin cytoskeleton. PFN1 4 shared pathwaysRap1 signaling pathway, Regulation of actin cytoskeleton, Shigellosis, Salmonella infection Related via 4 shared pathways including Rap1 signaling pathway, Regulation of actin cytoskeleton. ENAH 2 shared pathwaysRap1 signaling pathway, Regulation of actin cytoskeleton Related via 2 shared pathways including Rap1 signaling pathway, Regulation of actin cytoskeleton. MYL10 3 shared pathwaysRegulation of actin cytoskeleton, Shigellosis, Salmonella infection Related via 3 shared pathways including Regulation of actin cytoskeleton, Shigellosis.
Major depressive disorder Linked via 2 of 5 related genesENAH, MYL10 Ocular hypotension Linked via 1 of 5 related genesPFN2 Amyotrophic lateral sclerosis Linked via 1 of 5 related genesPFN1 Esophageal squamous cell carcinoma Linked via 1 of 5 related genesPFN1 amyotrophic lateral sclerosis type 18 Linked via 1 of 5 related genesPFN1