PARP3 (poly(ADP-ribose) polymerase family member 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 10039
• Gene name: Poly(ADP-ribose) polymerase family member 3
• Gene symbol: PARP3
• Synonyms (NCBI Gene): ADPRT3, ADPRTL2, ADPRTL3, ARTD3, IRT1, PADPRT-3
• Chromosome: 3
• Chromosome location: 3p21.2
• Summary: The protein encoded by this gene belongs to the PARP family. These enzymes modify nuclear proteins by poly-ADP-ribosylation, which is required for DNA repair, regulation of apoptosis, and maintenance of genomic stability. This gene encodes the poly(ADP-ri

miRNA Show/Hide all (74)

miRTarBase ID	miRNA	Experiments	Reference
MIRT449306	hsa-miR-4635	PAR-CLIP	22100165
MIRT449305	hsa-miR-630	PAR-CLIP	22100165
MIRT449304	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT449306	hsa-miR-4635	PAR-CLIP	22100165
MIRT449305	hsa-miR-630	PAR-CLIP	22100165
MIRT449304	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT1214573	hsa-miR-141	CLIP-seq
MIRT1214574	hsa-miR-200a	CLIP-seq
MIRT1214575	hsa-miR-217	CLIP-seq
MIRT1214576	hsa-miR-3190	CLIP-seq
MIRT1214577	hsa-miR-4269	CLIP-seq
MIRT1214578	hsa-miR-4491	CLIP-seq
MIRT1214579	hsa-miR-4645-5p	CLIP-seq
MIRT1214580	hsa-miR-4657	CLIP-seq
MIRT1214581	hsa-miR-4663	CLIP-seq
MIRT1214582	hsa-miR-4666-5p	CLIP-seq
MIRT1214583	hsa-miR-4673	CLIP-seq
MIRT1214584	hsa-miR-4695-3p	CLIP-seq
MIRT1214585	hsa-miR-4728-3p	CLIP-seq
MIRT1214586	hsa-miR-4755-3p	CLIP-seq
MIRT1214587	hsa-miR-4765	CLIP-seq
MIRT1214581	hsa-miR-4663	CLIP-seq
MIRT1214585	hsa-miR-4728-3p	CLIP-seq
MIRT1214587	hsa-miR-4765	CLIP-seq
MIRT1214577	hsa-miR-4269	CLIP-seq
MIRT1214579	hsa-miR-4645-5p	CLIP-seq
MIRT1214582	hsa-miR-4666-5p	CLIP-seq
MIRT1214583	hsa-miR-4673	CLIP-seq
MIRT1214584	hsa-miR-4695-3p	CLIP-seq
MIRT1214586	hsa-miR-4755-3p	CLIP-seq
MIRT1214587	hsa-miR-4765	CLIP-seq
MIRT1214573	hsa-miR-141	CLIP-seq
MIRT1214574	hsa-miR-200a	CLIP-seq
MIRT1214575	hsa-miR-217	CLIP-seq
MIRT1214584	hsa-miR-4695-3p	CLIP-seq
MIRT2392136	hsa-miR-1258	CLIP-seq
MIRT1214573	hsa-miR-141	CLIP-seq
MIRT1214574	hsa-miR-200a	CLIP-seq
MIRT1214575	hsa-miR-217	CLIP-seq
MIRT2392137	hsa-miR-935	CLIP-seq
MIRT1214573	hsa-miR-141	CLIP-seq
MIRT1214574	hsa-miR-200a	CLIP-seq
MIRT1214575	hsa-miR-217	CLIP-seq
MIRT2588266	hsa-miR-22	CLIP-seq
MIRT2588267	hsa-miR-300	CLIP-seq
MIRT2588268	hsa-miR-3163	CLIP-seq
MIRT1214576	hsa-miR-3190	CLIP-seq
MIRT2588269	hsa-miR-320a	CLIP-seq
MIRT2588270	hsa-miR-320b	CLIP-seq
MIRT2588271	hsa-miR-320c	CLIP-seq
MIRT2588272	hsa-miR-320d	CLIP-seq
MIRT2588273	hsa-miR-381	CLIP-seq
MIRT2588274	hsa-miR-4429	CLIP-seq
MIRT1214578	hsa-miR-4491	CLIP-seq
MIRT1214580	hsa-miR-4657	CLIP-seq
MIRT2588275	hsa-miR-4666-3p	CLIP-seq
MIRT1214582	hsa-miR-4666-5p	CLIP-seq
MIRT1214584	hsa-miR-4695-3p	CLIP-seq
MIRT2588276	hsa-miR-4789-5p	CLIP-seq
MIRT2588277	hsa-miR-938	CLIP-seq
MIRT1214573	hsa-miR-141	CLIP-seq
MIRT1214574	hsa-miR-200a	CLIP-seq
MIRT1214575	hsa-miR-217	CLIP-seq
MIRT2588268	hsa-miR-3163	CLIP-seq
MIRT1214576	hsa-miR-3190	CLIP-seq
MIRT2588269	hsa-miR-320a	CLIP-seq
MIRT2588270	hsa-miR-320b	CLIP-seq
MIRT2588271	hsa-miR-320c	CLIP-seq
MIRT2588272	hsa-miR-320d	CLIP-seq
MIRT2588274	hsa-miR-4429	CLIP-seq
MIRT1214578	hsa-miR-4491	CLIP-seq
MIRT1214580	hsa-miR-4657	CLIP-seq
MIRT1214582	hsa-miR-4666-5p	CLIP-seq
MIRT1214584	hsa-miR-4695-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (52)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000723	Process	Telomere maintenance	IMP	21270334
GO:0003824	Function	Catalytic activity	TAS
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	IBA
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	IDA	21211721, 21270334
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	IEA
GO:0005515	Function	Protein binding	IPI	20064938, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005814	Component	Centriole	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006302	Process	Double-strand break repair	IBA
GO:0006302	Process	Double-strand break repair	IDA	21270334
GO:0006302	Process	Double-strand break repair	IEA
GO:0006302	Process	Double-strand break repair	IEA
GO:0006302	Process	Double-strand break repair	IMP	21211721
GO:0006303	Process	Double-strand break repair via nonhomologous end joining	IGI	21211721
GO:0006974	Process	DNA damage response	IEA
GO:0010558	Process	Negative regulation of macromolecule biosynthetic process	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0016779	Function	Nucleotidyltransferase activity	IEA
GO:0030592	Process	DNA ADP-ribosylation	IDA	29361132
GO:0030592	Process	DNA ADP-ribosylation	IEA
GO:0032211	Process	Negative regulation of telomere maintenance via telomerase	TAS	24528514
GO:0035861	Component	Site of double-strand break	IBA
GO:0035861	Component	Site of double-strand break	IDA	21270334
GO:0035861	Component	Site of double-strand break	IEA
GO:0045171	Component	Intercellular bridge	IDA
GO:0045829	Process	Negative regulation of isotype switching	IEA
GO:0045829	Process	Negative regulation of isotype switching	ISS
GO:0051053	Process	Negative regulation of DNA metabolic process	IEA
GO:0060236	Process	Regulation of mitotic spindle organization	IMP	21270334
GO:0070212	Process	Protein poly-ADP-ribosylation	IDA	25043379
GO:0070213	Process	Protein auto-ADP-ribosylation	IDA	25043379
GO:0070213	Process	Protein auto-ADP-ribosylation	IEA
GO:0140294	Function	NAD DNA ADP-ribosyltransferase activity	IDA	29361132
GO:0140294	Function	NAD DNA ADP-ribosyltransferase activity	IEA
GO:0140804	Function	NAD+-protein-lysine ADP-ribosyltransferase activity	IDA	25043379
GO:0140804	Function	NAD+-protein-lysine ADP-ribosyltransferase activity	IEA
GO:0140806	Function	NAD+-protein-aspartate ADP-ribosyltransferase activity	IDA	20064938, 25043379
GO:0140806	Function	NAD+-protein-aspartate ADP-ribosyltransferase activity	IEA
GO:0140807	Function	NAD+-protein-glutamate ADP-ribosyltransferase activity	IDA	20064938, 25043379
GO:0140807	Function	NAD+-protein-glutamate ADP-ribosyltransferase activity	IEA
GO:1990166	Process	Protein localization to site of double-strand break	IMP	21211721
GO:1990404	Function	NAD+-protein mono-ADP-ribosyltransferase activity	IDA	20064938, 24598253, 25043379
GO:2001034	Process	Positive regulation of double-strand break repair via nonhomologous end joining	IDA	24598253

Other IDs

• MIM: 607726
• HGNC: 273
• e!Ensembl: ENSG00000041880

Protein

• UniProt ID: Q9Y6F1
• Protein name: Protein mono-ADP-ribosyltransferase PARP3 (EC 2.4.2.-) (ADP-ribosyltransferase diphtheria toxin-like 3) (ARTD3) (DNA ADP-ribosyltransferase PARP3) (EC 2.4.2.-) (IRT1) (NAD(+) ADP-ribosyltransferase 3) (ADPRT-3) (Poly [ADP-ribose] polymerase 3) (PARP-3) (h
• Protein function: Mono-ADP-ribosyltransferase that mediates mono-ADP-ribosylation of target proteins and plays a key role in the response to DNA damage (PubMed:16924674, PubMed:19354255, PubMed:20064938, PubMed:21211721, PubMed:21270334, PubMed:23742272, PubMed:2
• PDB: 2EOC , 3C49 , 3C4H , 3CE0 , 3FHB , 4GV0 , 4GV2 , 4GV4 , 4L6Z , 4L70 , 4L7L , 4L7N , 4L7O , 4L7P , 4L7R , 4L7U
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00644	PARP	333 → 533	Poly(ADP-ribose) polymerase catalytic domain	Family
  PF02877	PARP_reg	183 → 319	Poly(ADP-ribose) polymerase, regulatory domain	Domain
  PF05406	WGR	66 → 144	WGR domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed; the highest levels are in the kidney, skeletal muscle, liver, heart and spleen; also detected in pancreas, lung, placenta, brain, leukocytes, colon, small intestine, ovary, testis, prostate and thymus. {ECO:0000269|Pu
• Sequence:

  MAPKPKPWVQTEGPEKKKGRQAGREEDPFRSTAEALKAIPAEKRIIRVDPTCPLSSNPGT
  QVYEDYNCTLNQTNIENNNNKFYIIQLLQDSNRFFTCWNRWGRVGEVGQSKINHFTRLED
  AKKDFEKKFREKTKNNWAERDHFVSHPGKYTLIEVQAEDEAQEAVVKVDRGPVRTVTKRV
  QPCSLDPATQKLITNIFSKEMFKNTMALMDLDVKKMPLGKLSKQQIARGFEALEALEEAL
  KGPTDGGQSLEELSSHFYTVIPHNFGHSQPPPINSPELLQAKKDMLLVLADIELAQALQA
  VSEQEKTVEEVPHPLDRDYQLLKCQLQLLDSGAPEYKVIQTYLEQTGSNHRCPTLQHIWK
  VNQEGEEDRFQAHSKLGNRKLLWHGTNMAVVAAILTSGLRIMPHSGGRVGKGIYFASENS
  KSAGYVIGMKCGAHHVGYMFLGEVALGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPT
  QDTELELDGQQVVVPQGQPVPCPEFSSSTFSQSEYLIYQESQCRLRYLLEVHL

• Sequence length: 533

Pathways

KEGG Pathway

Base excision repair

Apoptosis

Related Genes

Sort by: Blended Diseases Pathways Evidence source

PARP4 2 shared pathwaysBase excision repair, Apoptosis Related via 2 shared pathways including Base excision repair, Apoptosis. PARP2 2 shared pathwaysBase excision repair, Apoptosis Related via 2 shared pathways including Base excision repair, Apoptosis. PARP1 2 shared pathwaysBase excision repair, Apoptosis Related via 2 shared pathways including Base excision repair, Apoptosis.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PARP4	0	[]	2	["Base excision repair","Apoptosis"]	0	[]
PARP2	0	[]	2	["Base excision repair","Apoptosis"]	0	[]
PARP1	0	[]	2	["Base excision repair","Apoptosis"]	0	[]

Diseases Linked via Similar Genes

Colorectal cancer Linked via 2 of 3 related genesPARP2, PARP1 Colonic neoplasms Linked via 1 of 3 related genesPARP4 Lipodystrophy Linked via 1 of 3 related genesPARP2 Alzheimer disease Linked via 1 of 3 related genesPARP1 Anemia Linked via 1 of 3 related genesPARP1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Colorectal cancer	2	["PARP2","PARP1"]
Colonic neoplasms	1	["PARP4"]
Lipodystrophy	1	["PARP2"]
Alzheimer disease	1	["PARP1"]
Anemia	1	["PARP1"]