PARP1 (poly(ADP-ribose) polymerase 1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 142
• Gene name: Poly(ADP-ribose) polymerase 1
• Gene symbol: PARP1
• Synonyms (NCBI Gene): ADPRT, ADPRT 1, ADPRT1, ARTD1, PARP, PARP-1, PARS, PPOL, Poly-PARP, pADPRT-1
• Chromosome: 1
• Chromosome location: 1q42.12
• Summary: This gene encodes a chromatin-associated enzyme, poly(ADP-ribosyl)transferase, which modifies various nuclear proteins by poly(ADP-ribosyl)ation. The modification is dependent on DNA and is involved in the regulation of various important cellular processe

miRNA Show/Hide all (572)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019791	hsa-miR-375	qRT-PCR;Microarray	20584986
MIRT030724	hsa-miR-21-5p	Microarray	18591254
MIRT052650	hsa-miR-223-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23757351
MIRT046137	hsa-miR-30b-5p	CLASH	23622248
MIRT046091	hsa-miR-125b-5p	CLASH	23622248
MIRT045879	hsa-miR-128-3p	CLASH	23622248
MIRT045417	hsa-miR-149-5p	CLASH	23622248
MIRT042808	hsa-miR-339-5p	CLASH	23622248
MIRT041920	hsa-miR-484	CLASH	23622248
MIRT041220	hsa-miR-193b-3p	CLASH	23622248
MIRT041220	hsa-miR-193b-3p	CLASH	23622248
MIRT039741	hsa-miR-615-3p	CLASH	23622248
MIRT039741	hsa-miR-615-3p	CLASH	23622248
MIRT038771	hsa-miR-93-3p	CLASH	23622248
MIRT037766	hsa-miR-874-3p	CLASH	23622248
MIRT036540	hsa-miR-1225-3p	CLASH	23622248
MIRT036020	hsa-miR-1301-3p	CLASH	23622248
MIRT437390	hsa-miR-708-5p	Flow, qRT-PCR, Western blot	23754151
MIRT573914	hsa-miR-4475	PAR-CLIP	20371350
MIRT573913	hsa-miR-3925-5p	PAR-CLIP	20371350
MIRT573912	hsa-miR-3123	PAR-CLIP	20371350
MIRT573910	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT573911	hsa-miR-1253	PAR-CLIP	20371350
MIRT573909	hsa-miR-6770-5p	PAR-CLIP	20371350
MIRT573908	hsa-miR-365a-5p	PAR-CLIP	20371350
MIRT573907	hsa-miR-365b-5p	PAR-CLIP	20371350
MIRT573906	hsa-miR-580-3p	PAR-CLIP	20371350
MIRT573905	hsa-miR-1303	PAR-CLIP	20371350
MIRT516569	hsa-miR-619-3p	PAR-CLIP	20371350
MIRT516568	hsa-miR-7851-3p	PAR-CLIP	20371350
MIRT516567	hsa-miR-221-5p	PAR-CLIP	20371350
MIRT516566	hsa-miR-8073	PAR-CLIP	20371350
MIRT516564	hsa-miR-3128	PAR-CLIP	20371350
MIRT516565	hsa-miR-31-5p	PAR-CLIP	20371350
MIRT516563	hsa-miR-6809-5p	PAR-CLIP	20371350
MIRT516569	hsa-miR-619-3p	PAR-CLIP	20371350
MIRT516568	hsa-miR-7851-3p	PAR-CLIP	20371350
MIRT516567	hsa-miR-221-5p	PAR-CLIP	20371350
MIRT516566	hsa-miR-8073	PAR-CLIP	20371350
MIRT516564	hsa-miR-3128	PAR-CLIP	20371350
MIRT516565	hsa-miR-31-5p	PAR-CLIP	20371350
MIRT516563	hsa-miR-6809-5p	PAR-CLIP	20371350
MIRT504292	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT504291	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT504290	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT504289	hsa-miR-302a-3p	PAR-CLIP	20371350
MIRT504288	hsa-miR-302b-3p	PAR-CLIP	20371350
MIRT504287	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT504286	hsa-miR-302d-3p	PAR-CLIP	20371350
MIRT504285	hsa-miR-302e	PAR-CLIP	20371350
MIRT504284	hsa-miR-372-3p	PAR-CLIP	20371350
MIRT504283	hsa-miR-373-3p	PAR-CLIP	20371350
MIRT504282	hsa-miR-520a-3p	PAR-CLIP	20371350
MIRT504281	hsa-miR-520b	PAR-CLIP	20371350
MIRT504280	hsa-miR-520c-3p	PAR-CLIP	20371350
MIRT504279	hsa-miR-520d-3p	PAR-CLIP	20371350
MIRT504278	hsa-miR-520e	PAR-CLIP	20371350
MIRT504277	hsa-miR-577	PAR-CLIP	20371350
MIRT504276	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT504275	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT504274	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT504273	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT504272	hsa-miR-3666	PAR-CLIP	20371350
MIRT504271	hsa-miR-4295	PAR-CLIP	20371350
MIRT504270	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT504269	hsa-miR-4696	PAR-CLIP	20371350
MIRT504268	hsa-miR-4799-5p	PAR-CLIP	20371350
MIRT547211	hsa-miR-7-5p	PAR-CLIP	21572407
MIRT547210	hsa-miR-129-1-3p	PAR-CLIP	21572407
MIRT547209	hsa-miR-129-2-3p	PAR-CLIP	21572407
MIRT547208	hsa-miR-4687-5p	PAR-CLIP	21572407
MIRT547207	hsa-miR-6779-3p	PAR-CLIP	21572407
MIRT547206	hsa-miR-3189-3p	PAR-CLIP	21572407
MIRT547205	hsa-miR-6077	PAR-CLIP	21572407
MIRT547204	hsa-miR-555	PAR-CLIP	21572407
MIRT547203	hsa-miR-4650-3p	PAR-CLIP	21572407
MIRT547202	hsa-miR-3529-5p	PAR-CLIP	21572407
MIRT547201	hsa-miR-379-5p	PAR-CLIP	21572407
MIRT547200	hsa-miR-4451	PAR-CLIP	21572407
MIRT547199	hsa-miR-4536-5p	PAR-CLIP	21572407
MIRT547198	hsa-miR-4775	PAR-CLIP	21572407
MIRT547197	hsa-miR-6079	PAR-CLIP	21572407
MIRT547196	hsa-miR-1225-5p	PAR-CLIP	21572407
MIRT547195	hsa-miR-1229-5p	PAR-CLIP	21572407
MIRT504292	hsa-miR-519a-3p	PAR-CLIP	22012620
MIRT504291	hsa-miR-519b-3p	PAR-CLIP	22012620
MIRT504290	hsa-miR-519c-3p	PAR-CLIP	22012620
MIRT504289	hsa-miR-302a-3p	PAR-CLIP	22012620
MIRT504288	hsa-miR-302b-3p	PAR-CLIP	22012620
MIRT504287	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT504286	hsa-miR-302d-3p	PAR-CLIP	22012620
MIRT504285	hsa-miR-302e	PAR-CLIP	22012620
MIRT504284	hsa-miR-372-3p	PAR-CLIP	22012620
MIRT504283	hsa-miR-373-3p	PAR-CLIP	22012620
MIRT504282	hsa-miR-520a-3p	PAR-CLIP	22012620
MIRT504281	hsa-miR-520b	PAR-CLIP	22012620
MIRT504280	hsa-miR-520c-3p	PAR-CLIP	22012620
MIRT504279	hsa-miR-520d-3p	PAR-CLIP	22012620
MIRT504278	hsa-miR-520e	PAR-CLIP	22012620
MIRT504277	hsa-miR-577	PAR-CLIP	22012620
MIRT504276	hsa-miR-130a-3p	PAR-CLIP	22012620
MIRT504275	hsa-miR-130b-3p	PAR-CLIP	22012620
MIRT504274	hsa-miR-301a-3p	PAR-CLIP	22012620
MIRT504273	hsa-miR-301b-3p	PAR-CLIP	22012620
MIRT504272	hsa-miR-3666	PAR-CLIP	22012620
MIRT504271	hsa-miR-4295	PAR-CLIP	22012620
MIRT504270	hsa-miR-454-3p	PAR-CLIP	22012620
MIRT504269	hsa-miR-4696	PAR-CLIP	22012620
MIRT504268	hsa-miR-4799-5p	PAR-CLIP	22012620
MIRT516569	hsa-miR-619-3p	PAR-CLIP	23446348
MIRT516568	hsa-miR-7851-3p	PAR-CLIP	23446348
MIRT516567	hsa-miR-221-5p	PAR-CLIP	23446348
MIRT516566	hsa-miR-8073	PAR-CLIP	23446348
MIRT516564	hsa-miR-3128	PAR-CLIP	23446348
MIRT516565	hsa-miR-31-5p	PAR-CLIP	23446348
MIRT516563	hsa-miR-6809-5p	PAR-CLIP	23446348
MIRT504292	hsa-miR-519a-3p	PAR-CLIP	23446348
MIRT504291	hsa-miR-519b-3p	PAR-CLIP	23446348
MIRT504290	hsa-miR-519c-3p	PAR-CLIP	23446348
MIRT504289	hsa-miR-302a-3p	PAR-CLIP	23446348
MIRT504288	hsa-miR-302b-3p	PAR-CLIP	23446348
MIRT504287	hsa-miR-302c-3p	PAR-CLIP	23446348
MIRT504286	hsa-miR-302d-3p	PAR-CLIP	23446348
MIRT504285	hsa-miR-302e	PAR-CLIP	23446348
MIRT504284	hsa-miR-372-3p	PAR-CLIP	23446348
MIRT504283	hsa-miR-373-3p	PAR-CLIP	23446348
MIRT504282	hsa-miR-520a-3p	PAR-CLIP	23446348
MIRT504281	hsa-miR-520b	PAR-CLIP	23446348
MIRT504280	hsa-miR-520c-3p	PAR-CLIP	23446348
MIRT504279	hsa-miR-520d-3p	PAR-CLIP	23446348
MIRT504278	hsa-miR-520e	PAR-CLIP	23446348
MIRT504277	hsa-miR-577	PAR-CLIP	23446348
MIRT504276	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT504275	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT504274	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT504273	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT504272	hsa-miR-3666	PAR-CLIP	23446348
MIRT504271	hsa-miR-4295	PAR-CLIP	23446348
MIRT504270	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT504269	hsa-miR-4696	PAR-CLIP	23446348
MIRT504268	hsa-miR-4799-5p	PAR-CLIP	23446348
MIRT504292	hsa-miR-519a-3p	PAR-CLIP	23446348
MIRT504291	hsa-miR-519b-3p	PAR-CLIP	23446348
MIRT504290	hsa-miR-519c-3p	PAR-CLIP	23446348
MIRT504289	hsa-miR-302a-3p	PAR-CLIP	23446348
MIRT504288	hsa-miR-302b-3p	PAR-CLIP	23446348
MIRT504287	hsa-miR-302c-3p	PAR-CLIP	23446348
MIRT504286	hsa-miR-302d-3p	PAR-CLIP	23446348
MIRT504285	hsa-miR-302e	PAR-CLIP	23446348
MIRT504284	hsa-miR-372-3p	PAR-CLIP	23446348
MIRT504283	hsa-miR-373-3p	PAR-CLIP	23446348
MIRT504282	hsa-miR-520a-3p	PAR-CLIP	23446348
MIRT504281	hsa-miR-520b	PAR-CLIP	23446348
MIRT504280	hsa-miR-520c-3p	PAR-CLIP	23446348
MIRT504279	hsa-miR-520d-3p	PAR-CLIP	23446348
MIRT504278	hsa-miR-520e	PAR-CLIP	23446348
MIRT504277	hsa-miR-577	PAR-CLIP	23446348
MIRT504276	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT504275	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT504274	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT504273	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT504272	hsa-miR-3666	PAR-CLIP	23446348
MIRT504271	hsa-miR-4295	PAR-CLIP	23446348
MIRT504270	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT504269	hsa-miR-4696	PAR-CLIP	23446348
MIRT504268	hsa-miR-4799-5p	PAR-CLIP	23446348
MIRT731987	hsa-miR-216b-5p	Luciferase reporter assay, qRT-PCR, Western blot	28281524
MIRT731987	hsa-miR-216b-5p	Luciferase reporter assay, qRT-PCR, Western blot	28281524
MIRT731987	hsa-miR-216b-5p	Luciferase reporter assay, qRT-PCR, Western blot	28281524
MIRT731987	hsa-miR-216b-5p	Luciferase reporter assay, qRT-PCR, Western blot	28281524
MIRT732378	hsa-miR-335-5p	Luciferase reporter assay, qRT-PCR, Western blot	27871924
MIRT732378	hsa-miR-335-5p	Luciferase reporter assay, qRT-PCR, Western blot	27871924
MIRT732467	hsa-miR-124-3p	Luciferase reporter assay, Western blotting	34131409
MIRT734287	hsa-miR-17-5p	Western blotting	32442343
MIRT732467	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR	32641757
MIRT573914	hsa-miR-4475	PAR-CLIP	20371350
MIRT573913	hsa-miR-3925-5p	PAR-CLIP	20371350
MIRT573912	hsa-miR-3123	PAR-CLIP	20371350
MIRT573910	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT573911	hsa-miR-1253	PAR-CLIP	20371350
MIRT573909	hsa-miR-6770-5p	PAR-CLIP	20371350
MIRT573908	hsa-miR-365a-5p	PAR-CLIP	20371350
MIRT573907	hsa-miR-365b-5p	PAR-CLIP	20371350
MIRT573906	hsa-miR-580-3p	PAR-CLIP	20371350
MIRT573905	hsa-miR-1303	PAR-CLIP	20371350
MIRT516569	hsa-miR-619-3p	PAR-CLIP	20371350
MIRT516568	hsa-miR-7851-3p	PAR-CLIP	20371350
MIRT516567	hsa-miR-221-5p	PAR-CLIP	20371350
MIRT516566	hsa-miR-8073	PAR-CLIP	20371350
MIRT516564	hsa-miR-3128	PAR-CLIP	20371350
MIRT516565	hsa-miR-31-5p	PAR-CLIP	20371350
MIRT516563	hsa-miR-6809-5p	PAR-CLIP	20371350
MIRT516569	hsa-miR-619-3p	PAR-CLIP	20371350
MIRT516568	hsa-miR-7851-3p	PAR-CLIP	20371350
MIRT516567	hsa-miR-221-5p	PAR-CLIP	20371350
MIRT516566	hsa-miR-8073	PAR-CLIP	20371350
MIRT516564	hsa-miR-3128	PAR-CLIP	20371350
MIRT516565	hsa-miR-31-5p	PAR-CLIP	20371350
MIRT516563	hsa-miR-6809-5p	PAR-CLIP	20371350
MIRT504292	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT504291	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT504290	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT504289	hsa-miR-302a-3p	PAR-CLIP	20371350
MIRT504288	hsa-miR-302b-3p	PAR-CLIP	20371350
MIRT504287	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT504286	hsa-miR-302d-3p	PAR-CLIP	20371350
MIRT504285	hsa-miR-302e	PAR-CLIP	20371350
MIRT504284	hsa-miR-372-3p	PAR-CLIP	20371350
MIRT504283	hsa-miR-373-3p	PAR-CLIP	20371350
MIRT504282	hsa-miR-520a-3p	PAR-CLIP	20371350
MIRT504281	hsa-miR-520b	PAR-CLIP	20371350
MIRT504280	hsa-miR-520c-3p	PAR-CLIP	20371350
MIRT504279	hsa-miR-520d-3p	PAR-CLIP	20371350
MIRT504278	hsa-miR-520e	PAR-CLIP	20371350
MIRT504277	hsa-miR-577	PAR-CLIP	20371350
MIRT504276	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT504275	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT504274	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT504273	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT504272	hsa-miR-3666	PAR-CLIP	20371350
MIRT504271	hsa-miR-4295	PAR-CLIP	20371350
MIRT504270	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT504269	hsa-miR-4696	PAR-CLIP	20371350
MIRT504268	hsa-miR-4799-5p	PAR-CLIP	20371350
MIRT547211	hsa-miR-7-5p	PAR-CLIP	21572407
MIRT547210	hsa-miR-129-1-3p	PAR-CLIP	21572407
MIRT547209	hsa-miR-129-2-3p	PAR-CLIP	21572407
MIRT547208	hsa-miR-4687-5p	PAR-CLIP	21572407
MIRT547207	hsa-miR-6779-3p	PAR-CLIP	21572407
MIRT547206	hsa-miR-3189-3p	PAR-CLIP	21572407
MIRT547205	hsa-miR-6077	PAR-CLIP	21572407
MIRT547204	hsa-miR-555	PAR-CLIP	21572407
MIRT547203	hsa-miR-4650-3p	PAR-CLIP	21572407
MIRT547202	hsa-miR-3529-5p	PAR-CLIP	21572407
MIRT547201	hsa-miR-379-5p	PAR-CLIP	21572407
MIRT547200	hsa-miR-4451	PAR-CLIP	21572407
MIRT547199	hsa-miR-4536-5p	PAR-CLIP	21572407
MIRT547198	hsa-miR-4775	PAR-CLIP	21572407
MIRT547197	hsa-miR-6079	PAR-CLIP	21572407
MIRT547196	hsa-miR-1225-5p	PAR-CLIP	21572407
MIRT547195	hsa-miR-1229-5p	PAR-CLIP	21572407
MIRT504292	hsa-miR-519a-3p	PAR-CLIP	22012620
MIRT504291	hsa-miR-519b-3p	PAR-CLIP	22012620
MIRT504290	hsa-miR-519c-3p	PAR-CLIP	22012620
MIRT504289	hsa-miR-302a-3p	PAR-CLIP	22012620
MIRT504288	hsa-miR-302b-3p	PAR-CLIP	22012620
MIRT504287	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT504286	hsa-miR-302d-3p	PAR-CLIP	22012620
MIRT504285	hsa-miR-302e	PAR-CLIP	22012620
MIRT504284	hsa-miR-372-3p	PAR-CLIP	22012620
MIRT504283	hsa-miR-373-3p	PAR-CLIP	22012620
MIRT504282	hsa-miR-520a-3p	PAR-CLIP	22012620
MIRT504281	hsa-miR-520b	PAR-CLIP	22012620
MIRT504280	hsa-miR-520c-3p	PAR-CLIP	22012620
MIRT504279	hsa-miR-520d-3p	PAR-CLIP	22012620
MIRT504278	hsa-miR-520e	PAR-CLIP	22012620
MIRT504277	hsa-miR-577	PAR-CLIP	22012620
MIRT504276	hsa-miR-130a-3p	PAR-CLIP	22012620
MIRT504275	hsa-miR-130b-3p	PAR-CLIP	22012620
MIRT504274	hsa-miR-301a-3p	PAR-CLIP	22012620
MIRT504273	hsa-miR-301b-3p	PAR-CLIP	22012620
MIRT504272	hsa-miR-3666	PAR-CLIP	22012620
MIRT504271	hsa-miR-4295	PAR-CLIP	22012620
MIRT504270	hsa-miR-454-3p	PAR-CLIP	22012620
MIRT504269	hsa-miR-4696	PAR-CLIP	22012620
MIRT504268	hsa-miR-4799-5p	PAR-CLIP	22012620
MIRT516569	hsa-miR-619-3p	PAR-CLIP	23446348
MIRT516568	hsa-miR-7851-3p	PAR-CLIP	23446348
MIRT516567	hsa-miR-221-5p	PAR-CLIP	23446348
MIRT516566	hsa-miR-8073	PAR-CLIP	23446348
MIRT516564	hsa-miR-3128	PAR-CLIP	23446348
MIRT516565	hsa-miR-31-5p	PAR-CLIP	23446348
MIRT516563	hsa-miR-6809-5p	PAR-CLIP	23446348
MIRT504292	hsa-miR-519a-3p	PAR-CLIP	23446348
MIRT504291	hsa-miR-519b-3p	PAR-CLIP	23446348
MIRT504290	hsa-miR-519c-3p	PAR-CLIP	23446348
MIRT504289	hsa-miR-302a-3p	PAR-CLIP	23446348
MIRT504288	hsa-miR-302b-3p	PAR-CLIP	23446348
MIRT504287	hsa-miR-302c-3p	PAR-CLIP	23446348
MIRT504286	hsa-miR-302d-3p	PAR-CLIP	23446348
MIRT504285	hsa-miR-302e	PAR-CLIP	23446348
MIRT504284	hsa-miR-372-3p	PAR-CLIP	23446348
MIRT504283	hsa-miR-373-3p	PAR-CLIP	23446348
MIRT504282	hsa-miR-520a-3p	PAR-CLIP	23446348
MIRT504281	hsa-miR-520b	PAR-CLIP	23446348
MIRT504280	hsa-miR-520c-3p	PAR-CLIP	23446348
MIRT504279	hsa-miR-520d-3p	PAR-CLIP	23446348
MIRT504278	hsa-miR-520e	PAR-CLIP	23446348
MIRT504277	hsa-miR-577	PAR-CLIP	23446348
MIRT504276	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT504275	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT504274	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT504273	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT504272	hsa-miR-3666	PAR-CLIP	23446348
MIRT504271	hsa-miR-4295	PAR-CLIP	23446348
MIRT504270	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT504269	hsa-miR-4696	PAR-CLIP	23446348
MIRT504268	hsa-miR-4799-5p	PAR-CLIP	23446348
MIRT504292	hsa-miR-519a-3p	PAR-CLIP	23446348
MIRT504291	hsa-miR-519b-3p	PAR-CLIP	23446348
MIRT504290	hsa-miR-519c-3p	PAR-CLIP	23446348
MIRT504289	hsa-miR-302a-3p	PAR-CLIP	23446348
MIRT504288	hsa-miR-302b-3p	PAR-CLIP	23446348
MIRT504287	hsa-miR-302c-3p	PAR-CLIP	23446348
MIRT504286	hsa-miR-302d-3p	PAR-CLIP	23446348
MIRT504285	hsa-miR-302e	PAR-CLIP	23446348
MIRT504284	hsa-miR-372-3p	PAR-CLIP	23446348
MIRT504283	hsa-miR-373-3p	PAR-CLIP	23446348
MIRT504282	hsa-miR-520a-3p	PAR-CLIP	23446348
MIRT504281	hsa-miR-520b	PAR-CLIP	23446348
MIRT504280	hsa-miR-520c-3p	PAR-CLIP	23446348
MIRT504279	hsa-miR-520d-3p	PAR-CLIP	23446348
MIRT504278	hsa-miR-520e	PAR-CLIP	23446348
MIRT504277	hsa-miR-577	PAR-CLIP	23446348
MIRT504276	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT504275	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT504274	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT504273	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT504272	hsa-miR-3666	PAR-CLIP	23446348
MIRT504271	hsa-miR-4295	PAR-CLIP	23446348
MIRT504270	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT504269	hsa-miR-4696	PAR-CLIP	23446348
MIRT504268	hsa-miR-4799-5p	PAR-CLIP	23446348
MIRT755541	hsa-miR-181c-5p	Western blotting, qRT-PCR	36676955
MIRT732467	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR	36448327
MIRT755814	hsa-miR-124-5p	Luciferase reporter assay, qRT-PCR	36448327
MIRT734287	hsa-miR-17-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	36246167
MIRT1214452	hsa-miR-124	CLIP-seq
MIRT1214453	hsa-miR-125a-3p	CLIP-seq
MIRT1214454	hsa-miR-2110	CLIP-seq
MIRT1214455	hsa-miR-219-1-3p	CLIP-seq
MIRT1214456	hsa-miR-298	CLIP-seq
MIRT1214457	hsa-miR-299-5p	CLIP-seq
MIRT1214458	hsa-miR-3121-3p	CLIP-seq
MIRT1214459	hsa-miR-3129-3p	CLIP-seq
MIRT1214460	hsa-miR-3166	CLIP-seq
MIRT1214461	hsa-miR-3190	CLIP-seq
MIRT1214462	hsa-miR-3607-3p	CLIP-seq
MIRT1214463	hsa-miR-3667-3p	CLIP-seq
MIRT1214464	hsa-miR-3686	CLIP-seq
MIRT1214465	hsa-miR-3714	CLIP-seq
MIRT1214466	hsa-miR-3910	CLIP-seq
MIRT1214467	hsa-miR-4271	CLIP-seq
MIRT1214468	hsa-miR-4292	CLIP-seq
MIRT1214469	hsa-miR-4303	CLIP-seq
MIRT1214470	hsa-miR-4308	CLIP-seq
MIRT1214471	hsa-miR-4321	CLIP-seq
MIRT1214472	hsa-miR-4453	CLIP-seq
MIRT1214473	hsa-miR-4538	CLIP-seq
MIRT1214474	hsa-miR-4649-3p	CLIP-seq
MIRT1214475	hsa-miR-4652-3p	CLIP-seq
MIRT1214476	hsa-miR-4667-5p	CLIP-seq
MIRT1214477	hsa-miR-4668-3p	CLIP-seq
MIRT1214478	hsa-miR-4700-5p	CLIP-seq
MIRT1214479	hsa-miR-4725-3p	CLIP-seq
MIRT1214480	hsa-miR-4762-3p	CLIP-seq
MIRT1214481	hsa-miR-500a	CLIP-seq
MIRT1214482	hsa-miR-501-5p	CLIP-seq
MIRT1214483	hsa-miR-506	CLIP-seq
MIRT1214484	hsa-miR-518e	CLIP-seq
MIRT1214485	hsa-miR-545	CLIP-seq
MIRT1214486	hsa-miR-552	CLIP-seq
MIRT1214487	hsa-miR-571	CLIP-seq
MIRT1214488	hsa-miR-580	CLIP-seq
MIRT1214489	hsa-miR-660	CLIP-seq
MIRT1214490	hsa-miR-670	CLIP-seq
MIRT1214491	hsa-miR-876-3p	CLIP-seq
MIRT1214492	hsa-miR-891b	CLIP-seq
MIRT1214452	hsa-miR-124	CLIP-seq
MIRT1214453	hsa-miR-125a-3p	CLIP-seq
MIRT2061706	hsa-miR-134	CLIP-seq
MIRT1214454	hsa-miR-2110	CLIP-seq
MIRT1214455	hsa-miR-219-1-3p	CLIP-seq
MIRT1214456	hsa-miR-298	CLIP-seq
MIRT1214457	hsa-miR-299-5p	CLIP-seq
MIRT2061707	hsa-miR-3117-3p	CLIP-seq
MIRT2061708	hsa-miR-3118	CLIP-seq
MIRT2061709	hsa-miR-3164	CLIP-seq
MIRT1214460	hsa-miR-3166	CLIP-seq
MIRT2061710	hsa-miR-3169	CLIP-seq
MIRT1214462	hsa-miR-3607-3p	CLIP-seq
MIRT2061711	hsa-miR-3613-3p	CLIP-seq
MIRT1214463	hsa-miR-3667-3p	CLIP-seq
MIRT1214464	hsa-miR-3686	CLIP-seq
MIRT1214465	hsa-miR-3714	CLIP-seq
MIRT1214466	hsa-miR-3910	CLIP-seq
MIRT1214467	hsa-miR-4271	CLIP-seq
MIRT1214468	hsa-miR-4292	CLIP-seq
MIRT1214470	hsa-miR-4308	CLIP-seq
MIRT1214471	hsa-miR-4321	CLIP-seq
MIRT2061712	hsa-miR-4452	CLIP-seq
MIRT1214472	hsa-miR-4453	CLIP-seq
MIRT2061713	hsa-miR-4455	CLIP-seq
MIRT1214473	hsa-miR-4538	CLIP-seq
MIRT2061714	hsa-miR-4638-5p	CLIP-seq
MIRT1214475	hsa-miR-4652-3p	CLIP-seq
MIRT1214476	hsa-miR-4667-5p	CLIP-seq
MIRT1214477	hsa-miR-4668-3p	CLIP-seq
MIRT1214478	hsa-miR-4700-5p	CLIP-seq
MIRT1214479	hsa-miR-4725-3p	CLIP-seq
MIRT2061715	hsa-miR-4759	CLIP-seq
MIRT2061716	hsa-miR-4760-3p	CLIP-seq
MIRT2061717	hsa-miR-485-3p	CLIP-seq
MIRT1214481	hsa-miR-500a	CLIP-seq
MIRT1214482	hsa-miR-501-5p	CLIP-seq
MIRT1214483	hsa-miR-506	CLIP-seq
MIRT1214484	hsa-miR-518e	CLIP-seq
MIRT1214485	hsa-miR-545	CLIP-seq
MIRT2061718	hsa-miR-548ae	CLIP-seq
MIRT2061719	hsa-miR-548aj	CLIP-seq
MIRT2061720	hsa-miR-548am	CLIP-seq
MIRT2061721	hsa-miR-548x	CLIP-seq
MIRT1214486	hsa-miR-552	CLIP-seq
MIRT1214487	hsa-miR-571	CLIP-seq
MIRT1214488	hsa-miR-580	CLIP-seq
MIRT2061722	hsa-miR-587	CLIP-seq
MIRT1214489	hsa-miR-660	CLIP-seq
MIRT1214490	hsa-miR-670	CLIP-seq
MIRT1214491	hsa-miR-876-3p	CLIP-seq
MIRT1214492	hsa-miR-891b	CLIP-seq
MIRT1214452	hsa-miR-124	CLIP-seq
MIRT1214453	hsa-miR-125a-3p	CLIP-seq
MIRT2061706	hsa-miR-134	CLIP-seq
MIRT2290092	hsa-miR-200b	CLIP-seq
MIRT2290093	hsa-miR-200c	CLIP-seq
MIRT1214454	hsa-miR-2110	CLIP-seq
MIRT2290094	hsa-miR-216b	CLIP-seq
MIRT1214455	hsa-miR-219-1-3p	CLIP-seq
MIRT2290095	hsa-miR-223	CLIP-seq
MIRT1214456	hsa-miR-298	CLIP-seq
MIRT1214457	hsa-miR-299-5p	CLIP-seq
MIRT2061707	hsa-miR-3117-3p	CLIP-seq
MIRT2061708	hsa-miR-3118	CLIP-seq
MIRT2290096	hsa-miR-3124-3p	CLIP-seq
MIRT2290097	hsa-miR-3143	CLIP-seq
MIRT2061709	hsa-miR-3164	CLIP-seq
MIRT1214460	hsa-miR-3166	CLIP-seq
MIRT2061710	hsa-miR-3169	CLIP-seq
MIRT1214461	hsa-miR-3190	CLIP-seq
MIRT2290098	hsa-miR-335	CLIP-seq
MIRT1214462	hsa-miR-3607-3p	CLIP-seq
MIRT1214463	hsa-miR-3667-3p	CLIP-seq
MIRT1214464	hsa-miR-3686	CLIP-seq
MIRT1214465	hsa-miR-3714	CLIP-seq
MIRT2290099	hsa-miR-374c	CLIP-seq
MIRT1214466	hsa-miR-3910	CLIP-seq
MIRT2290100	hsa-miR-3925-3p	CLIP-seq
MIRT1214467	hsa-miR-4271	CLIP-seq
MIRT2290101	hsa-miR-429	CLIP-seq
MIRT1214468	hsa-miR-4292	CLIP-seq
MIRT1214469	hsa-miR-4303	CLIP-seq
MIRT1214470	hsa-miR-4308	CLIP-seq
MIRT1214471	hsa-miR-4321	CLIP-seq
MIRT2290102	hsa-miR-4328	CLIP-seq
MIRT2061712	hsa-miR-4452	CLIP-seq
MIRT1214472	hsa-miR-4453	CLIP-seq
MIRT2061713	hsa-miR-4455	CLIP-seq
MIRT1214473	hsa-miR-4538	CLIP-seq
MIRT1214474	hsa-miR-4649-3p	CLIP-seq
MIRT1214475	hsa-miR-4652-3p	CLIP-seq
MIRT1214476	hsa-miR-4667-5p	CLIP-seq
MIRT1214477	hsa-miR-4668-3p	CLIP-seq
MIRT2290103	hsa-miR-4684-5p	CLIP-seq
MIRT2290104	hsa-miR-4697-3p	CLIP-seq
MIRT1214478	hsa-miR-4700-5p	CLIP-seq
MIRT2290105	hsa-miR-4716-5p	CLIP-seq
MIRT1214479	hsa-miR-4725-3p	CLIP-seq
MIRT2061715	hsa-miR-4759	CLIP-seq
MIRT2061716	hsa-miR-4760-3p	CLIP-seq
MIRT1214480	hsa-miR-4762-3p	CLIP-seq
MIRT2290106	hsa-miR-4768-5p	CLIP-seq
MIRT2290107	hsa-miR-4804-3p	CLIP-seq
MIRT2061717	hsa-miR-485-3p	CLIP-seq
MIRT2290108	hsa-miR-498	CLIP-seq
MIRT1214481	hsa-miR-500a	CLIP-seq
MIRT1214482	hsa-miR-501-5p	CLIP-seq
MIRT1214483	hsa-miR-506	CLIP-seq
MIRT1214484	hsa-miR-518e	CLIP-seq
MIRT1214485	hsa-miR-545	CLIP-seq
MIRT1214486	hsa-miR-552	CLIP-seq
MIRT1214487	hsa-miR-571	CLIP-seq
MIRT1214488	hsa-miR-580	CLIP-seq
MIRT2061722	hsa-miR-587	CLIP-seq
MIRT2290109	hsa-miR-655	CLIP-seq
MIRT1214489	hsa-miR-660	CLIP-seq
MIRT1214490	hsa-miR-670	CLIP-seq
MIRT2290110	hsa-miR-766	CLIP-seq
MIRT1214491	hsa-miR-876-3p	CLIP-seq
MIRT1214492	hsa-miR-891b	CLIP-seq
MIRT1214455	hsa-miR-219-1-3p	CLIP-seq
MIRT1214457	hsa-miR-299-5p	CLIP-seq
MIRT1214469	hsa-miR-4303	CLIP-seq
MIRT1214474	hsa-miR-4649-3p	CLIP-seq
MIRT1214485	hsa-miR-545	CLIP-seq
MIRT1214486	hsa-miR-552	CLIP-seq
MIRT1214487	hsa-miR-571	CLIP-seq
MIRT1214489	hsa-miR-660	CLIP-seq
MIRT1214491	hsa-miR-876-3p	CLIP-seq
MIRT1214452	hsa-miR-124	CLIP-seq
MIRT1214453	hsa-miR-125a-3p	CLIP-seq
MIRT1214454	hsa-miR-2110	CLIP-seq
MIRT1214455	hsa-miR-219-1-3p	CLIP-seq
MIRT1214457	hsa-miR-299-5p	CLIP-seq
MIRT2061707	hsa-miR-3117-3p	CLIP-seq
MIRT1214460	hsa-miR-3166	CLIP-seq
MIRT2061710	hsa-miR-3169	CLIP-seq
MIRT1214461	hsa-miR-3190	CLIP-seq
MIRT1214462	hsa-miR-3607-3p	CLIP-seq
MIRT1214463	hsa-miR-3667-3p	CLIP-seq
MIRT1214464	hsa-miR-3686	CLIP-seq
MIRT1214465	hsa-miR-3714	CLIP-seq
MIRT1214466	hsa-miR-3910	CLIP-seq
MIRT1214467	hsa-miR-4271	CLIP-seq
MIRT1214468	hsa-miR-4292	CLIP-seq
MIRT1214469	hsa-miR-4303	CLIP-seq
MIRT1214470	hsa-miR-4308	CLIP-seq
MIRT1214471	hsa-miR-4321	CLIP-seq
MIRT1214472	hsa-miR-4453	CLIP-seq
MIRT1214473	hsa-miR-4538	CLIP-seq
MIRT1214474	hsa-miR-4649-3p	CLIP-seq
MIRT1214475	hsa-miR-4652-3p	CLIP-seq
MIRT1214476	hsa-miR-4667-5p	CLIP-seq
MIRT1214477	hsa-miR-4668-3p	CLIP-seq
MIRT1214478	hsa-miR-4700-5p	CLIP-seq
MIRT1214479	hsa-miR-4725-3p	CLIP-seq
MIRT2061715	hsa-miR-4759	CLIP-seq
MIRT1214480	hsa-miR-4762-3p	CLIP-seq
MIRT1214481	hsa-miR-500a	CLIP-seq
MIRT1214482	hsa-miR-501-5p	CLIP-seq
MIRT1214483	hsa-miR-506	CLIP-seq
MIRT1214485	hsa-miR-545	CLIP-seq
MIRT1214486	hsa-miR-552	CLIP-seq
MIRT1214487	hsa-miR-571	CLIP-seq
MIRT1214488	hsa-miR-580	CLIP-seq
MIRT2061722	hsa-miR-587	CLIP-seq
MIRT1214489	hsa-miR-660	CLIP-seq
MIRT1214490	hsa-miR-670	CLIP-seq
MIRT1214491	hsa-miR-876-3p	CLIP-seq
MIRT1214492	hsa-miR-891b	CLIP-seq
MIRT1214452	hsa-miR-124	CLIP-seq
MIRT1214453	hsa-miR-125a-3p	CLIP-seq
MIRT1214454	hsa-miR-2110	CLIP-seq
MIRT1214457	hsa-miR-299-5p	CLIP-seq
MIRT1214460	hsa-miR-3166	CLIP-seq
MIRT1214461	hsa-miR-3190	CLIP-seq
MIRT1214462	hsa-miR-3607-3p	CLIP-seq
MIRT1214463	hsa-miR-3667-3p	CLIP-seq
MIRT1214464	hsa-miR-3686	CLIP-seq
MIRT1214465	hsa-miR-3714	CLIP-seq
MIRT1214466	hsa-miR-3910	CLIP-seq
MIRT1214467	hsa-miR-4271	CLIP-seq
MIRT1214468	hsa-miR-4292	CLIP-seq
MIRT1214469	hsa-miR-4303	CLIP-seq
MIRT1214470	hsa-miR-4308	CLIP-seq
MIRT1214471	hsa-miR-4321	CLIP-seq
MIRT1214474	hsa-miR-4649-3p	CLIP-seq
MIRT1214475	hsa-miR-4652-3p	CLIP-seq
MIRT1214476	hsa-miR-4667-5p	CLIP-seq
MIRT1214477	hsa-miR-4668-3p	CLIP-seq
MIRT1214478	hsa-miR-4700-5p	CLIP-seq
MIRT1214479	hsa-miR-4725-3p	CLIP-seq
MIRT1214480	hsa-miR-4762-3p	CLIP-seq
MIRT1214481	hsa-miR-500a	CLIP-seq
MIRT1214482	hsa-miR-501-5p	CLIP-seq
MIRT1214483	hsa-miR-506	CLIP-seq
MIRT1214485	hsa-miR-545	CLIP-seq
MIRT1214486	hsa-miR-552	CLIP-seq
MIRT1214488	hsa-miR-580	CLIP-seq
MIRT1214489	hsa-miR-660	CLIP-seq
MIRT1214490	hsa-miR-670	CLIP-seq
MIRT1214491	hsa-miR-876-3p	CLIP-seq
MIRT1214492	hsa-miR-891b	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
EP300	Unknown	17065349
ETS1	Activation	11973649;24448423
ETS1	Repression	10435618
YY1	Unknown	9367892

Gene ontology (GO) Show/Hide all (163)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	15607977, 22464733
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS
GO:0000723	Process	Telomere maintenance	TAS	25749521
GO:0000724	Process	Double-strand break repair via homologous recombination	IDA	18417535, 26811421, 35597237
GO:0000781	Component	Chromosome, telomeric region	HDA	19135898
GO:0000785	Component	Chromatin	IDA	30675909, 34874266
GO:0000785	Component	Chromatin	IDA	35013556
GO:0002376	Process	Immune system process	IEA
GO:0003677	Function	DNA binding	IDA	21233213
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	2513174
GO:0003682	Function	Chromatin binding	IDA	30675909, 34874266, 35013556
GO:0003684	Function	Damaged DNA binding	IDA	22683995, 26626479, 26626480, 27568560, 30675909, 32241924, 32358582, 37823600
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003824	Function	Catalytic activity	IEA
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	IBA
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	IDA	7852410, 16107709, 17396150, 18055453, 19470756, 19764761, 20388712, 23275542, 26626479, 26626480, 28190768, 30104678, 32028527, 32241924, 32358582, 33186521, 33683197, 34732825, 34795260, 35219381
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	IEA
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	IMP	22504299
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	TAS	2513174
GO:0005515	Function	Protein binding	IPI	7596430, 9518481, 11248244, 14596914, 14627987, 14734561, 15044383, 15555565, 16107709, 16490787, 17167422, 17396150, 18172500, 18971944, 19661379, 19666485, 19710015, 19779455, 20064938, 20098424, 20133863, 21266351, 21549307, 21575865, 21577210, 21799911, 22504299, 22863007, 23213
GO:0005634	Component	Nucleus	IDA	22464733, 27256882, 34102106, 35393539, 35460603
GO:0005634	Component	Nucleus	IDA	17177976, 22504299, 37823600
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	2513174
GO:0005635	Component	Nuclear envelope	IDA	9518481
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IDA	19303849
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA	9518481, 16107709
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	25378300
GO:0005829	Component	Cytosol	IDA	35460603
GO:0005829	Component	Cytosol	IEA
GO:0006281	Process	DNA repair	IDA	21211722, 30104678, 30675909, 32028527, 33186521, 34486521, 34874266
GO:0006281	Process	DNA repair	IDA	30104678, 30675909, 31796734, 32028527, 33186521, 34874266
GO:0006281	Process	DNA repair	IEA
GO:0006281	Process	DNA repair	TAS	10958667, 17396150
GO:0006302	Process	Double-strand break repair	IBA
GO:0006302	Process	Double-strand break repair	IDA	28190768, 32028527
GO:0006302	Process	Double-strand break repair	IDA	24906880, 27568560, 28190768, 32028527
GO:0006302	Process	Double-strand break repair	IMP	23230272
GO:0006366	Process	Transcription by RNA polymerase II	TAS	29849146
GO:0006366	Process	Transcription by RNA polymerase II	TAS	10944198
GO:0006915	Process	Apoptotic process	IDA	15565177
GO:0006915	Process	Apoptotic process	IEA
GO:0006974	Process	DNA damage response	IDA	32358582
GO:0006974	Process	DNA damage response	IDA	22683995, 32358582, 35013556, 35393539, 37823600
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	IMP	24550317
GO:0006974	Process	DNA damage response	IMP	24289924, 27067600, 27248496
GO:0007005	Process	Mitochondrion organization	IMP	25378300
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0008047	Function	Enzyme activator activity	IDA	25749521
GO:0008270	Function	Zinc ion binding	IDA	18055453, 21233213
GO:0008270	Function	Zinc ion binding	IEA
GO:0010332	Process	Response to gamma radiation	IEA
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	IEA
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	ISS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016051	Process	Carbohydrate biosynthetic process	IEA
GO:0016540	Process	Protein autoprocessing	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0016779	Function	Nucleotidyltransferase activity	IEA
GO:0019899	Function	Enzyme binding	IEA
GO:0019899	Function	Enzyme binding	IPI	23382074
GO:0019901	Function	Protein kinase binding	IPI	17177976
GO:0023019	Process	Signal transduction involved in regulation of gene expression	IEA
GO:0030225	Process	Macrophage differentiation	TAS	18309324
GO:0030331	Function	Nuclear estrogen receptor binding	IEA
GO:0030592	Process	DNA ADP-ribosylation	IDA	27471034
GO:0030592	Process	DNA ADP-ribosylation	IEA
GO:0031491	Function	Nucleosome binding	IDA	15607977, 31848352
GO:0031491	Function	Nucleosome binding	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0032042	Process	Mitochondrial DNA metabolic process	IMP	25378300
GO:0032786	Process	Positive regulation of DNA-templated transcription, elongation	IDA	27256882
GO:0032869	Process	Cellular response to insulin stimulus	IDA	19303849
GO:0032880	Process	Regulation of protein localization	IMP	24550317
GO:0032991	Component	Protein-containing complex	IDA	22504299, 25378300
GO:0032993	Component	Protein-DNA complex	IDA	22504299
GO:0033148	Process	Positive regulation of intracellular estrogen receptor signaling pathway	IEA
GO:0034244	Process	Negative regulation of transcription elongation by RNA polymerase II	IDA	27256882
GO:0034244	Process	Negative regulation of transcription elongation by RNA polymerase II	IDA	35393539
GO:0034599	Process	Cellular response to oxidative stress	IMP	25378300
GO:0034644	Process	Cellular response to UV	IMP	24289924
GO:0035861	Component	Site of double-strand break	IDA	29234005
GO:0035861	Component	Site of double-strand break	IDA	26344098, 27568560, 30356214
GO:0036211	Process	Protein modification process	IMP	25378300
GO:0042802	Function	Identical protein binding	IPI	14734561, 23481255
GO:0042803	Function	Protein homodimerization activity	IDA	22683995
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	22464733
GO:0043504	Process	Mitochondrial DNA repair	IMP	25378300
GO:0043596	Component	Nuclear replication fork	IDA	33412112
GO:0045087	Process	Innate immune response	IEA
GO:0045188	Process	Regulation of circadian sleep/wake cycle, non-REM sleep	ISS
GO:0045824	Process	Negative regulation of innate immune response	IDA	35460603
GO:0045824	Process	Negative regulation of innate immune response	IMP	32844745
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	11112786
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046697	Process	Decidualization	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0051287	Function	NAD binding	IEA
GO:0051901	Process	Positive regulation of mitochondrial depolarization	IEA
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IEA
GO:0060545	Process	Positive regulation of necroptotic process	ISS
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	19303849
GO:0070212	Process	Protein poly-ADP-ribosylation	IDA	28190768
GO:0070212	Process	Protein poly-ADP-ribosylation	IDA	15674325, 19470756, 25043379, 28190768, 33186521
GO:0070213	Process	Protein auto-ADP-ribosylation	IDA	15607977, 20388712, 29234005, 30675909, 32358582, 34210965, 34625544
GO:0070412	Function	R-SMAD binding	IEA
GO:0071168	Process	Protein localization to chromatin	IDA	21211722, 34874266
GO:0071168	Process	Protein localization to chromatin	IDA	34874266
GO:0071294	Process	Cellular response to zinc ion	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0071932	Process	Replication fork reversal	IDA	33412112
GO:0090734	Component	Site of DNA damage	IDA	22683995, 26626479, 26626480, 30104678, 30675909, 31796734, 32028527, 32241924, 32358582, 33186521, 34795260, 34874266
GO:0090734	Component	Site of DNA damage	IEA
GO:0090734	Component	Site of DNA damage	IMP	27248496
GO:0140294	Function	NAD DNA ADP-ribosyltransferase activity	IDA	27471034
GO:0140294	Function	NAD DNA ADP-ribosyltransferase activity	IEA
GO:0140537	Function	Transcription regulator activator activity	IEA
GO:0140805	Function	NAD+-protein-serine ADP-ribosyltransferase activity	IDA	28190768, 29234005, 32028527, 33186521, 33412112, 33589610, 33683197, 34210965, 34732825, 34795260, 34874266, 35393539
GO:0140805	Function	NAD+-protein-serine ADP-ribosyltransferase activity	IEA
GO:0140806	Function	NAD+-protein-aspartate ADP-ribosyltransferase activity	IDA	19764761, 25043379, 35460603
GO:0140806	Function	NAD+-protein-aspartate ADP-ribosyltransferase activity	IEA
GO:0140807	Function	NAD+-protein-glutamate ADP-ribosyltransferase activity	IDA	19764761, 27256882
GO:0140807	Function	NAD+-protein-glutamate ADP-ribosyltransferase activity	IEA
GO:0140808	Function	NAD+-protein-tyrosine ADP-ribosyltransferase activity	IDA	29954836, 30257210
GO:0140808	Function	NAD+-protein-tyrosine ADP-ribosyltransferase activity	IEA
GO:0140815	Function	NAD+-protein-histidine ADP-ribosyltransferase activity	IDA	35393539
GO:0140815	Function	NAD+-protein-histidine ADP-ribosyltransferase activity	IEA
GO:0140816	Function	NAD+-histone H2BS6 serine ADP-ribosyltransferase activity	IDA	34874266
GO:0140817	Function	NAD+-histone H3S10 serine ADP-ribosyltransferase activity	IDA	34874266
GO:0140822	Function	NAD+-histone H2BE35 glutamate ADP-ribosyltransferase activity	ISS
GO:0140861	Process	DNA repair-dependent chromatin remodeling	IDA	21211722
GO:0160049	Process	Negative regulation of cGAS/STING signaling pathway	IDA	35460603
GO:0160239	Process	Transcription pausing by RNA polymerase II	IDA	27256882
GO:1900182	Process	Positive regulation of protein localization to nucleus	IEA
GO:1901701	Process	Cellular response to oxygen-containing compound	IEA
GO:1903376	Process	Regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IEA
GO:1904044	Process	Response to aldosterone	IEA
GO:1904178	Process	Negative regulation of adipose tissue development	ISS
GO:1904179	Process	Positive regulation of adipose tissue development	ISS
GO:1904357	Process	Negative regulation of telomere maintenance via telomere lengthening	ISS
GO:1904646	Process	Cellular response to amyloid-beta	IEA
GO:1904762	Process	Positive regulation of myofibroblast differentiation	IEA
GO:1905051	Process	Regulation of base-excision repair	IDA	34102106
GO:1905168	Process	Positive regulation of double-strand break repair via homologous recombination	IDA	26344098, 30356214
GO:1990090	Process	Cellular response to nerve growth factor stimulus	IEA
GO:1990166	Process	Protein localization to site of double-strand break	IDA	35597237
GO:1990404	Function	NAD+-protein mono-ADP-ribosyltransferase activity	IDA	7852410, 19764761, 24906880, 25043379, 25533949, 26344098, 28190768, 31796734, 32028527, 33186521, 34049076, 34102106, 34625544
GO:1990966	Process	ATP generation from poly-ADP-D-ribose	IDA	27257257
GO:2001170	Process	Negative regulation of ATP biosynthetic process	IMP	24289924

Other IDs

• MIM: 173870
• HGNC: 270
• e!Ensembl: ENSG00000143799

Protein

• UniProt ID: P09874
• Protein name: Poly [ADP-ribose] polymerase 1 (PARP-1) (EC 2.4.2.30) (ADP-ribosyltransferase diphtheria toxin-like 1) (ARTD1) (DNA ADP-ribosyltransferase PARP1) (EC 2.4.2.-) (NAD(+) ADP-ribosyltransferase 1) (ADPRT 1) (Poly[ADP-ribose] synthase 1) (Protein poly-ADP-ribo
• Protein function: Poly-ADP-ribosyltransferase that mediates poly-ADP-ribosylation of proteins and plays a key role in DNA repair (PubMed:17177976, PubMed:18055453, PubMed:18172500, PubMed:19344625, PubMed:19661379, PubMed:20388712, PubMed:21680843, PubMed:2258226
• PDB: 1UK0 , 1UK1 , 1WOK , 2COK , 2CR9 , 2CS2 , 2DMJ , 2JVN , 2L30 , 2L31 , 2N8A , 2RCW , 2RD6 , 2RIQ , 3GJW , 3GN7 , 3L3L , 3L3M , 3OD8 , 3ODA , 3ODC , 3ODE , 4AV1 , 4DQY , 4GV7 , 4HHY , 4HHZ , 4L6S , 4OPX , 4OQA , 4OQB , 4PJT , 4R5W , 4R6E , 4RV6 , 4UND , 4UXB , 4XHU , 4ZZZ , 5A00 , 5DS3 , 5HA9 , 5KPN , 5KPO , 5KPP , 5KPQ , 5WRQ , 5WRY , 5WRZ , 5WS0 , 5WS1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00533	BRCT	385 → 462	BRCA1 C Terminus (BRCT) domain	Family
  PF00644	PARP	808 → 1007	Poly(ADP-ribose) polymerase catalytic domain	Family
  PF00645	zf-PARP	12 → 89	Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region	Domain
  PF00645	zf-PARP	116 → 199	Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region	Domain
  PF02877	PARP_reg	663 → 794	Poly(ADP-ribose) polymerase, regulatory domain	Domain
  PF05406	WGR	553 → 633	WGR domain	Domain
  PF08063	PADR1	280 → 331	PADR1 (NUC008) domain	Domain

• Sequence:

  MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKV
  GHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKS
  NRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQ
  LKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKA
  QNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG
  QLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPE
  TSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLT
  GTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSP
  WGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLE
  HSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNK
  LEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPG
  TKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAV
  SQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRG
  GSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIE
  REGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM
  VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA
  NISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW

• Sequence length: 1014

Pathways

KEGG Pathway	Reactome Pathway
Base excision repair	POLB-Dependent Long Patch Base Excision Repair
NF-kappa B signaling pathway	Downregulation of SMAD2/3:SMAD4 transcriptional activity
Apoptosis	SUMOylation of DNA damage response and repair proteins
Necroptosis	HDR through MMEJ (alt-NHEJ)
Diabetic cardiomyopathy	DNA Damage Recognition in GG-NER
	Formation of Incision Complex in GG-NER
	Dual Incision in GG-NER

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (63)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA	—	CTD, Disgenet CTD, Disgenet	20561897	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS AND OTHER INFLAMMATORY SPONDYLOPATHIES	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC ANEURYSM, ABDOMINAL	—	CTD	30354818	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet CTD, Disgenet	18261157	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	18093987, 19124646	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	17640816	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES, TRAUMATIC	—	CTD	15829224, 28642177	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	17640816	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	20941507	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	18695907	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	20561897	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEROID LIPOFUSCINOSIS, NEURONAL 1, INFANTILE	—	CTD	21224254	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEROID LIPOFUSCINOSIS, NEURONAL, 1	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	31178898	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLONAL HEMATOPOIESIS	—	GWAS catalog	39948438	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	27694308	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	29212778	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	30429480, 32341527, 34813871	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS	—	CTD, Disgenet CTD, Disgenet	20561897	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary renal cell carcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY	—	CTD	21937992	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE NEURONAL CEROID LIPOFUSCINOSIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	20561897, 21884784	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-INFANTILE NEURONAL CEROID LIPOFUSCINOSIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD, GWAS catalog CTD, GWAS catalog	21983785, 28759004, 32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL RETARDATION	—	Disgenet	21937992	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	21543585	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	CTD	21917757	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYELOPROLIFERATIVE DISORDER	—	GWAS catalog	37684235	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURONAL CEROID-LIPOFUSCINOSES	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	20561897	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATITIS	—	CTD, Disgenet CTD, Disgenet	16127429	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARALYSIS	—	CTD	15696051	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSONIAN DISORDERS	—	CTD, Disgenet CTD, Disgenet	17640816	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARP1-related disorder	Likely benign; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	15342424	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY EDEMA	—	CTD	11818323	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	27704718	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	CTD, Disgenet CTD, Disgenet	25811541	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	40050615	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitamin A deficiency	—	CTD, Disgenet CTD, Disgenet	18676402	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (579)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	29990873		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	27551000		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	25179837		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	23757351, 29531462		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	19571039, 26898760, 27655641, 28363999, 29453076, 29667179		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	17283177		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	17283177		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	15940627, 27334689		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	28698968, 29636359		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	34531868, 35848940	Associate	★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	25835728		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	28055012		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	24180296		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	CTD_human_DG	20561897		★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	CTD_human_DG	20561897		★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	27704718		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	20486200, 27034851, 27234294, 28558704	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	31827497	Inhibit	★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	31315986		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	26921778		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	29065557, 29654761, 31482248		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	LHGDN	12528821, 15019581		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	23570271, 24049082, 26190642, 30157956, 30728452		★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	CTD_human_DG	20561897		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	CTD_human_DG	20561897		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia	Anemia	BEFREE	20561897, 29075104		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia Aplastic	Aplastic anemia	Pubtator	38237741	Associate	★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	18996291		★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	LHGDN	18996291		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	20931645, 25864590		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	37449843	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	31794795		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	31794795		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	30354818		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arteriosclerosis	Arteriosclerosis	BEFREE	23085506, 30158868, 30394268, 31276434		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12632415, 15743888, 27626929	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12594058, 19484672, 21276008, 22532985, 24180296, 26169874, 26205779, 26339143, 28974953, 29355504, 31178661		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG	18261157		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	40634444	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	Pubtator	20423999, 28654422, 37924373	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	28654422		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	29348879		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	33571423	Associate	★☆☆☆☆ Found in Text Mining only
ATAXIA, EARLY-ONSET, WITH OCULOMOTOR APRAXIA AND HYPOALBUMINEMIA	Ataxia-oculomotor apraxia	BEFREE	19643912		★☆☆☆☆ Found in Text Mining only
Atelosteogenesis type 2	Atelosteogenesis	BEFREE	29407546		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	CTD_human_DG	19124646		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	23027378, 23085506, 25793984, 32981917	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	23085506, 30158868, 30394268, 31276434		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30898999		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	15868402, 26080611, 30315841		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	25865228, 26429911	Associate	★☆☆☆☆ Found in Text Mining only
Autosomal Dominant Juvenile Parkinson Disease	Parkinson Disease	CTD_human_DG	17640816		★☆☆☆☆ Found in Text Mining only
Autosomal Dominant Parkinsonism	Parkinsonian disease	CTD_human_DG	17640816		★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Parkinsonism	Parkinsonian disease	CTD_human_DG	17640816		★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	30717407		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	28853108	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	25310109, 26592553, 28314788, 28551635, 28713907, 28983625, 29085465, 29085508, 29104634, 29156828, 29434958, 29717768, 29928326, 30233696, 30251772, 31758388		★☆☆☆☆ Found in Text Mining only
Barakat syndrome	Hypoparathyroidism-deafness-renal disease syndrome	BEFREE	28477743		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	23757351, 29531462		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	34352995	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	38190860	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	17203305, 20218899, 22166496, 30786932		★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom syndrome	Pubtator	26181065, 28463527	Associate	★☆☆☆☆ Found in Text Mining only
BRACHYDACTYLY, TYPE B1	Brachydactyly	BEFREE	31280521		★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	19925161	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Injuries Traumatic	Brain injuries	Pubtator	18506195, 19925161	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	17640816		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Brain ischemia	Pubtator	19087198	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain neoplasms	Pubtator	23691191, 28099939, 31609976	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	25911198, 29572254		★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	22820987, 22968923, 24415413, 25511378, 25975349		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15456408, 16810332, 17560163, 17669606, 17943227, 18491400, 18701435, 18832051, 18837894, 19287209, 19934756, 20017885, 20568893, 21069454, 21409392, 21424107, 21908496, 22015278, 22166496, 22266096, 22485147, 22586318, 22915751, 22915752, 22948662, 23244082, 23272074, 23644255, 23803078, 24191908, 24337974, 24392019, 24962108, 25199834, 25333773, 25485588, 25528020, 25690937, 25769025, 25796377, 25975349, 25981734, 26022559, 26261599, 26530780, 26614429, 26703669, 26713604, 26801247, 26826460, 27323902, 27426307, 27666310, 27708239, 27997688, 28031413, 28034904, 28138868, 28167507, 28183251, 28395540, 28439535, 28583748, 28660502, 28692916, 28765325, 28770827, 29029467, 29133620, 29166620, 29180466, 29212245, 29382645, 29644491, 29684820, 29866945, 29874127, 29884921, 29917049, 30023007, 30038706, 30075398, 30181424, 30232143, 30234015, 30251552, 30324586, 30333000, 30410680, 30429212, 30520757, 30621214, 30647872, 30662357, 30873673, 30970626, 31015319, 31042381, 31151842, 31181965, 31261939, 31288058, 31322269, 31413177, 31442685, 31614656, 31753490, 31776133, 31784542, 9295059, 9816283		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	20941507		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Diseases	Breast disease	Pubtator	26183824, 35864202	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10400681, 15456408, 16251802, 16827122, 17897439, 18305410, 18701435, 19060926, 19724676, 21422199, 21700777, 22032731, 22166496, 22240506, 22416063, 22472897, 22869732, 22948662, 23244082, 23510475, 23656790, 23803078, 23825533, 23883585, 23917378, 24191908, 24252502, 24337974, 24392019, 24441188, 24625110, 25144364, 25199834, 25485588, 25528020, 25634209, 25690937, 25833211, 25865228, 26261599, 27385001, 27811964, 29166620, 31776133, 31784542, 32207233, 32345117, 32570693, 32649310, 33361107, 33652085, 34158394, 34356606, 34531868, 35217791, 35293552, 35715772, 35739271, 36006023, 36555812, 36622663, 36941223, 36990278, 37002487, 37240195, 37537243, 37587695, 38098088, 38199587	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	21821012, 39955949	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	28031413, 33184404, 40022708	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Calcinosis	Calcinosis	Pubtator	32981917, 37679327	Associate	★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	32844745	Associate	★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	23475579	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22412903, 25268610, 27656839, 28714367, 30183716, 31609976, 33112558, 36006023, 36991000, 39731187	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	19765735	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	20196871, 21409392, 24240112, 28991194, 29570891, 29617652, 30666631, 31827092		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20000738, 21410269, 22223166, 24367566, 25066396, 25543761, 26883192, 28498459, 3029772, 32705218, 33485358, 34531868, 37160416, 37356603	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28714367	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	24292451	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	30786684	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	29570891	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	17203305, 20218899, 22166496, 30786932		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17720873, 19029194, 23275151, 23966292, 24164298, 24191958, 25179837, 25225750, 25917567, 26307684, 28177129, 28848138, 29453076, 30195072, 30466996, 31216465, 31584889, 31753490		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	21293287, 24413181, 27155850, 30880072, 32594311, 34071938, 36739964	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	25590809, 28291774	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24595077	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28796254, 31081053, 32009115, 33741027, 34528699, 34531868, 36263616, 36999983	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	25374063, 31063862, 31125117	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22269178, 22454210, 22624032, 34531868	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	30447298		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	27372520		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19699512, 21187397, 22180407, 22983827, 23066035, 23442605, 23675882, 23729402, 24168967, 24413181, 24448423, 24727989, 24798692, 24984781, 25589624, 25634215, 26169965, 26520390, 26774475, 26787835, 26909613, 27016230, 27065456, 27169997, 27374179, 27810860, 27884198, 28454085, 28477743, 28601509, 28643177, 28692638, 28740454, 28790837, 28882436, 28933580, 28984489, 29037805, 29037806, 29081841, 29184090, 29189915, 29232464, 29254167, 29262321, 29262611, 29327913, 29352572, 29464354, 29509546, 29512470, 29567272, 29644491, 29684820, 29703482, 29871906, 30177437, 30266954, 30342021, 30353044, 30444904, 30540933, 30543930, 30551885, 30555227, 30661659, 30666631, 30926640, 30967398, 31037967, 31076742, 31117037, 31335830, 31500199, 31591108, 31594824, 31630846, 31653094, 31669203, 31722968, 31815769		★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	21422199	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	20561897		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	BEFREE	30359575		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	20561897		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	37462883	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	26091341, 32757651	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28302009, 29501586, 30323296, 31500199		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	16026592		★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	19533660		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	28095779		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	36448327, 40702735	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	10657571, 19087198, 25280774, 26339143, 29290984, 30260276, 31792665		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	19087198		★☆☆☆☆ Found in Text Mining only
Ceroid lipofuscinosis, neuronal 1, infantile	Neuronal ceroid lipofuscinosis	CTD_human_DG	21224254		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
cervical cancer	Cervical Cancer	BEFREE	23633189, 27323894, 28537893, 28993682, 30283446, 31303961, 31413820, 31434613		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	20464779, 22624032, 23633189, 27323894, 28537893, 28993682, 30283446, 31303961, 31434613		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	15596292		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	25835728		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	10209503, 32246704	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	31605774		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	31312595		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	34994649	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	39334838	Inhibit	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	27002766	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	27002766, 31201471		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	30867423		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	20353610, 29889834, 30867423		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Insufficiency	Renal Insufficiency	BEFREE	20353610		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22120020, 24439051, 25161998, 28034907, 28454364, 28751718, 28983606		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	26979391, 30615982		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	12594058, 23894640, 28974953		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	12853070		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	17084037, 17222947, 25881554, 26722405		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne syndrome	Pubtator	16107709	Associate	★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne Syndrome	BEFREE	27791127		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type II	Cockayne Syndrome	BEFREE	18473725		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	31827497	Associate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	27234294	Stimulate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	31827497	Inhibit	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	25533544, 25926267		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	3146530	Inhibit	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18006925, 20362665, 20559012, 22230687, 23636450, 23652727, 24885920, 25526641, 27064876, 27197561, 27815980, 29203587, 29335212, 30864743, 31199053, 31558316		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	22864776	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	25526641, 27746584, 31199053, 34531868	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	25526641		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21037106, 21300766, 22385513, 23430444, 24203816, 24215868, 24870775, 25526472, 26506418, 27746584, 28302009, 28886275, 29048575, 29632181, 30410539, 30477538, 30588113, 31190740		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	27694308		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21300766, 22194930, 22864776, 24870775, 25268610, 25526641, 26506418, 27197561, 27746584, 27902462, 28615517, 31199053, 31903985, 33076720, 33531658, 35468741, 36006023, 36611995, 36902215, 40235227, 40313151, 8434580	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	27694308		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	29632181		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Comedone	Comedone	BEFREE	22410125		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	24982429, 25292178, 29408941, 30910692		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	28913568		★☆☆☆☆ Found in Text Mining only
Congenital dyserythropoietic anemia	Congenital dyserythropoietic anemia	BEFREE	30717407		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	15374823, 30041821		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15144896, 15188008, 24595077, 29435132, 30273566, 31000589		★☆☆☆☆ Found in Text Mining only
Corneal Opacity	Corneal opacity	Pubtator	26990173	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	23040216, 28473439		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	32757651	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	29845299		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	28286054, 30299179		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	3146530	Inhibit	★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	16621887		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Degenerative polyarthritis	Arthritis	BEFREE	15743888		★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	40624693	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31556787		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	CTD_human_DG	20561897		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis	Dermatitis	BEFREE	25482287		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	12440774, 20824098, 26391545, 28013023, 28478229, 29164711, 31500199		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12440774, 15953818, 20824098, 26391545, 28013023, 28478229, 28695500, 29164711, 29238179, 31500199		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	19175688, 29238179	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	36333113	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32757651	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	11591122		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15895395, 23040216, 24621175, 25041504, 29392078		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	32757651	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	27561793		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	25041504, 28224182, 29751837		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	18054108, 29966615		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	LHGDN	18054108		★☆☆☆☆ Found in Text Mining only
Diabetic Polyneuropathies	Diabetic polyneuropathy	BEFREE	18054108		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	26391545, 28478229, 29912609		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	36333113	Stimulate	★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	18779313		★☆☆☆☆ Found in Text Mining only
Diffuse Intrinsic Pontine Glioma	Diffuse Intrinsic Pontine Glioma	BEFREE	28108511		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	28827325, 29104626, 29489886		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	24956560		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	2521372		★☆☆☆☆ Found in Text Mining only
Drug-Induced Stevens Johnson Syndrome	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★☆☆☆☆ Found in Text Mining only
Dysequilibrium syndrome	Dysequilibrium syndrome	Pubtator	37052975	Associate	★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Dyskeratosis congenita	Pubtator	12890806	Associate	★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Dyskeratosis congenita	Pubtator	29055871	Stimulate	★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	Pubtator	18445785	Associate	★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	BEFREE	18445785		★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	39424480	Associate	★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	30357520		★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	23762867		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	23762867, 27470351, 28454476, 28886696, 29436682		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	23762867	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	24625059, 28886696, 32360251, 34531868, 36006023, 36566215, 36946269	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30447298		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	21276008		★☆☆☆☆ Found in Text Mining only
Epidermal Nevus	Epidermal nevus	Pubtator	25307738	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31794795		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	19699512, 24413181, 24798692, 25634215, 27374179, 28477743, 28740454, 29037805, 29232464, 29262321, 29512470, 30444904, 30661659, 31037967, 31076742, 31653094		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	31002369		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	31002369		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	33112558	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	24033642, 24219164, 32374927, 33112558, 37838281	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	22287547, 23966622, 25779942, 26056084, 26505995, 28899971, 29358035, 29371919, 29513652, 30348635, 31724813		★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	16412052	Associate	★☆☆☆☆ Found in Text Mining only
Familial benign pemphigus	Benign Pemphigus	BEFREE	25658765		★☆☆☆☆ Found in Text Mining only
Familial Juvenile Parkinsonism	Parkinsonian disease	CTD_human_DG	17640816		★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	28540598, 30478958		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	23762867, 31002369		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	LHGDN	12674511		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	12749865, 22264603, 23966292, 25583207, 25609062, 26848151		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	20068062	Associate	★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	12749865, 22264603, 23966292, 25583207, 25609062, 26848151		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	27979751		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29719629		★☆☆☆☆ Found in Text Mining only
Fibroatheroma	Fibroatheroma	CTD_human_DG	19124646		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	14557488, 15536154, 15572421		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	30289618		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28757911		★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	BEFREE	26388025		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	28302009		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	15709096, 15868402, 20113831		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	23576132		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	28129013		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	11772428, 19318434, 20532243, 22472897, 24593254, 25182801, 28099939, 28241425, 28656196, 32565597, 34531868, 37651725, 39273083, 39277626	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	17127074, 19318434, 20532243, 21775006, 23807292, 24032376, 24593254, 24647572, 25531448, 26438157, 26794465, 27655368, 27845331, 28314386, 28654422, 29572254, 29935053, 29961065, 29976574, 30092165, 30627327, 30723695, 30832617, 31266951, 31827085		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19318434	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28654422	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	17127074, 19318434, 20532243, 21775006, 23807292, 24032376, 24593254, 24647572, 25531448, 25576921, 26438157, 26794465, 27655368, 27845331, 28314386, 28654422, 29572254, 29935053, 29961065, 29976574, 30092165, 30627327, 30723695, 30832617, 31266951, 31827085		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	17196947, 19124499, 20868244, 22127734, 22689924, 24500421, 24853559, 25576921, 25911198, 26559910, 26683770, 27055523, 27181592, 28350112, 28777431, 31489712		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	19124499, 21849329, 22184287, 23244082, 25273058, 27893811, 28202508, 28777431, 34531868, 35981653, 36809279, 37277492	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	19124499		★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	28055012		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	24956560, 28177666		★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	11112786	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	30936621		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	21719137, 21912620	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	17088946, 35147204	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	29278652		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	15374823, 30041821		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	17088946	Associate	★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	34085099	Associate	★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	28695521		★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	24184271	Associate	★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	29497996		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	31511432		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	22869732, 22983061, 24841718	Inhibit	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	23656790, 24033642, 28754563, 32193285, 33525353, 33581682, 36941223, 39273190	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary Breast And Ovarian Cancer Syndrome	BEFREE	31002019		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	36344544	Stimulate	★☆☆☆☆ Found in Text Mining only
Hereditary Malignant Neoplasm	Hereditary cancer	BEFREE	27590317		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	29866945		★☆☆☆☆ Found in Text Mining only
Heredodegenerative Disorders, Nervous System	Heredodegenerative Disorders, Nervous System	BEFREE	31324530		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	31065944		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	15895395, 28478229, 29392078		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	36333113	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	25831079	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	28660007	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	25041504, 28339485, 28660007		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	17322376	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	17600131	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25271986, 32296107, 33581682, 35409364, 36484652	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	28399901, 31131495		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	24270264, 26084306		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31164820		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	29497996		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	21706479		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31827497		★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	25106941	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	3146530	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	31413177		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	CTD_human_DG	21937992		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	29880585		★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Intestinal Polyposis	BEFREE	15940627		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	30961678		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	29990833, 30177808		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28370165, 29383691, 29709770, 30260276		★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	38020537	Associate	★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	27551000		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	25356504		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	CTD_human_DG	20561897, 21884784		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	BEFREE	28224182		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney disease	Pubtator	34531868	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	BEFREE	11867628, 29599129		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	30867423		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	31686145		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	30323866		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	30541756, 31131495, 34301934, 37143137	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	31131495		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11313278, 15142883, 19407318, 19671751, 20704577, 25390937, 26619102, 27064363, 31928132, 33924032, 35130631, 37358557, 37683650, 37967363	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15142883, 18941120, 1901731, 25828893, 28299675, 28481221, 29296788, 29423093, 29898385, 29990873, 31633196, 31775111		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	16323285		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	19407318, 29967475	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10233386, 18160664, 20557671, 22550344, 23349304, 25483710, 32423430, 33911178, 34207065, 34789078, 35130631, 37683650	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	15899912	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	29797327	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	3106933, 34789078	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	24435446, 25483710, 27503200, 27728808, 28673584, 29339439, 29633598, 29812960, 30472087, 30559256, 30615982, 31028744, 31623402, 31633196		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	27551000, 29797327, 31623402		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	19604089		★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	29049980		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	26900125, 28856922, 31768967		★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	31131495		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	31131495	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	28399901		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15375506		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18059167, 19897602, 21721027, 25499136, 26661118, 27041572, 27300349, 28069043, 28384634, 28487110, 28498459, 28714367, 28983625, 29179487, 29200736, 29776974, 30400960, 30573522, 30964366, 31815045		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	21703211		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	24085778, 25077527, 29200736, 30964366		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	17720873, 18612434, 21976407, 23275151, 23451039, 23591868, 23951099, 25179837, 26647102, 29072615, 29108454, 29306194, 31481733, 32859985, 33284833, 36006023, 36755223	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	22606268, 23275151, 24164298		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	17703177		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	10207165, 27492607	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	17703177		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10207165, 17703177, 30991045		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	17703177		★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	24874429		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	1907096, 29976663		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	21956491, 28394191, 37329186	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	20196871		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	20196871		★☆☆☆☆ Found in Text Mining only
Lynch Syndrome	Lynch Syndrome	BEFREE	29866945		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	34982643	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	30936621		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	24841718, 25143154, 27605053		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	21489980, 21543585		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	21543585		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15456408, 16810332, 17560163, 17943227, 18491400, 18701435, 18832051, 18837894, 19287209, 19934756, 20017885, 20127978, 20568893, 20582464, 20802015, 21069454, 21409392, 21424107, 21908496, 22015278, 22166496, 22266096, 22485147, 22586318, 22915751, 22915752, 22948662, 22987487, 23244082, 23272074, 23644255, 23803078, 23883585, 24191908, 24337974, 24392019, 24962108, 25111287, 25199834, 25333773, 25485588, 25528020, 25690937, 25769025, 25796377, 25833211, 25975349, 25981734, 26022559, 26261599, 26317927, 26530780, 26614429, 26703669, 26713604, 26801247, 26826460, 27323902, 27426307, 27666310, 27708239, 27997688, 28031413, 28034904, 28138868, 28167507, 28183251, 28254786, 28395540, 28439535, 28583748, 28660502, 28692916, 28765325, 28770827, 29029467, 29133620, 29166620, 29180466, 29212245, 29382645, 29644491, 29684820, 29866945, 29874127, 29884921, 29917049, 29923797, 30023007, 30038706, 30075398, 30108102, 30181424, 30232143, 30234015, 30251552, 30275858, 30297533, 30324586, 30333000, 30410680, 30429212, 30520757, 30573522, 30621214, 30647872, 30662357, 30755715, 30873673, 31015319, 31042381, 31151842, 31181965, 31261939, 31288058, 31322269, 31413177, 31442685, 31456944, 31614656, 31753490, 31776133, 31784542, 9295059		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	20941507		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	23762867, 28454476, 28886696		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	31002369		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	28302009		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	25543761, 31815045		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17720873, 19029194, 23275151, 23966292, 24164298, 24191958, 24853559, 25179837, 25225750, 25917567, 26307684, 28177129, 28848138, 29453076, 30195072, 30466996, 31216465, 31584889, 31753490		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	26900125, 28856922, 31768967		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	18837894, 21187397, 22180407, 22983827, 22987487, 23442605, 23675882, 23729402, 23847380, 24168967, 24448423, 24727989, 24984781, 25292178, 25437005, 25490527, 25589624, 26169965, 26520390, 26745875, 26774475, 26787835, 26909613, 27016230, 27065456, 27169997, 27282964, 27702817, 27810860, 27884198, 28454085, 28601509, 28643177, 28692638, 28747513, 28754563, 28756516, 28790837, 28882436, 28933580, 28984489, 29021870, 29037806, 29081841, 29184090, 29189915, 29254167, 29262611, 29327913, 29352572, 29464354, 29509546, 29512470, 29567272, 29615458, 29617652, 29644491, 29684820, 29703482, 29866945, 29871906, 30177437, 30266954, 30342021, 30353044, 30540933, 30543930, 30551885, 30555227, 30666631, 30797591, 30926640, 31117037, 31126961, 31303961, 31335830, 31500199, 31591108, 31594824, 31630846, 31669203, 31722968, 31815769		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	20931645, 21508395, 23833311, 24534203, 24889936, 25117293, 25864590, 26881472, 28656219, 29434894, 30407790, 30614530, 30635165, 30660828, 30681819, 30940721		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12664070, 15342424, 15868402, 16490787, 21385925, 21571912, 22001597, 22179663, 22666381, 22993403, 23807292, 23847380, 24204199, 24239883, 24866151, 25127709, 25173886, 25583815, 26026052, 26210103, 26909613, 27169997, 27188668, 27426307, 27590317, 27596623, 27600766, 27994514, 28323658, 28415632, 28450426, 28540598, 28583748, 28676700, 28851861, 29063620, 29138344, 29187880, 29393407, 29465803, 29500400, 29526801, 30195072, 30234108, 30305041, 30478958, 30880062, 31006810, 31060606, 31232159, 31310591, 31796516		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	15342424		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	23807292		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	18716896, 21612407, 22221038, 22374853, 22901183, 23317230, 26511885, 26540566, 31174925		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	22922830, 22982218, 30183716		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	17203305, 20218899, 22166496, 30786932		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11781113, 12707040, 15743666, 15836799, 15868402, 16123586, 17943227, 18832051, 18837894, 19533660, 19568233, 19873981, 19934756, 20351092, 20464779, 20568893, 21034216, 21360002, 21424107, 21487248, 21822267, 22078487, 22127734, 22128301, 22337872, 22586318, 22983061, 22993403, 23073772, 23193155, 23254695, 23436410, 23512992, 23691191, 23847380, 23881923, 23893925, 24189460, 24204199, 24225019, 24240700, 24415413, 24489833, 24535435, 24577941, 24698998, 24853559, 24889936, 24898058, 24916104, 24939750, 24958807, 25199834, 25268610, 25286972, 25555679, 25686825, 25833690, 25851856, 26091341, 26169874, 26184161, 26339143, 26658963, 26898760, 26979391, 27169997, 27315035, 27323894, 27334689, 27426307, 27440269, 27550963, 27610459, 27671334, 27702817, 27728808, 27884198, 27995810, 28002809, 28003236, 28013023, 28034904, 28078281, 28086241, 28146604, 28167507, 28202508, 28212373, 28302009, 28302823, 28336669, 28356425, 28388401, 28415632, 28439535, 28454476, 28457938, 28462496, 28482792, 28510338, 28583748, 28601509, 28610746, 28628639, 28646019, 28692916, 28695500, 28695517, 28695521, 28699513, 28714367, 28747513, 28763648, 28765325, 28789382, 28790064, 28802254, 28823558, 28827325, 28847819, 28978150, 28985359, 28991194, 28993682, 29016348, 29037806, 29112893, 29113422, 29138344, 29152062, 29152107, 29179487, 29180466, 29203587, 29260919, 29306194, 29327913, 29352572, 29414021, 29472838, 29475156, 29590171, 29620483, 29812960, 29866945, 29871906, 29928967, 29976574, 30012480, 30140387, 30183716, 30201826, 30203829, 30274183, 30289618, 30308112, 30352801, 30395643, 30427217, 30429212, 30467127, 30472087, 30551210, 30593284, 30647846, 30658897, 30675909, 30723695, 30733193, 30743082, 30760478, 30824778, 30844273, 30857266, 30874560, 30877373, 30940648, 30989114, 30996287, 31013702, 31015914, 31078910, 31092408, 31105872, 31133874, 31153806, 31185206, 31186408, 31202733, 31217354, 31257855, 31273204, 31299316, 31306986, 31351877, 31362565, 31395352, 31395736, 31416802, 31466918, 31549216, 31594824, 31609976, 31614656, 31676982, 31727767, 31753490, 31766720, 31827085, 9295059		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	26650448		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	23633189, 27323894, 28537893, 28993682, 30283446, 31303961, 31434613		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18006925, 20559012, 22230687, 23636450, 24885920, 25526641, 27064876, 27197561, 29203587, 29335212, 31558316		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	21818634	Associate	★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	20941507		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17560163, 17943227		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	20941507		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	22820987, 24131964, 27385001, 28031413, 29180466, 29212245, 30554948, 31499327		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	20941507		★☆☆☆☆ Found in Text Mining only
Mandibulofacial Dysostosis	Mandibulofacial Dysostosis	BEFREE	30280214		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	24841718, 25143154, 26658105, 27605053		★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	24577941		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	22184287, 37783879	Associate	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	25835728		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	25307738		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16084940, 16799643, 20837404, 21832879, 21983785, 22203954, 23537197, 24535833, 25837821, 26880244, 27476724, 28759004, 29074620, 31801187, 32380691, 32811446, 33572647, 36241419, 36484652, 37013641, 37674529, 37924516	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	16621887, 20464779, 20837404, 22203954, 23537197, 24535833, 25837821, 26880244, 27476724, 27705909, 28208804, 28759004, 31133874, 31615091, 31783660		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	GWASDB_DG	21983785		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	GWASCAT_DG	21983785		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	28759004		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma Cutaneous Malignant	Melanoma	Pubtator	16084940, 18752052, 33572647, 34531868	Associate	★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory disorders	Pubtator	31827497	Associate	★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	30177808		★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere Disease	BEFREE	19863315		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	25118896	Associate	★☆☆☆☆ Found in Text Mining only
Mental deficiency	Mental retardation	CTD_human_DG	21937992		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31556787		★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	29570891		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	23525508, 28223140		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	28090191	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	21289517, 21489980, 23301673, 28389374, 28756516, 32429658	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	26091343, 27090903, 28013023		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28883796		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	23785295		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	28450425, 29248718, 31732654		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	19429011, 27234294, 29051731, 31827497		★☆☆☆☆ Found in Text Mining only
Mitochondrial complex I deficiency	Mitochondrial complex deficiency	Pubtator	27689878	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	21600017, 22198485, 22994717, 23409113, 23666923, 27689878, 29045036, 31276581, 38272357	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	29516570	Inhibit	★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	31819047		★☆☆☆☆ Found in Text Mining only
MOHR-TRANEBJAERG SYNDROME	MOHR-TRANEBJAERG SYNDROME	BEFREE	29048624		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	29632340		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	22882088, 24337492	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	27827950	Stimulate	★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis IV	Mucopolysaccharidosis	Pubtator	37762422	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11474117, 16487170, 22471522, 23913134, 29467487, 29969371, 31564190, 32079692, 35414773, 36861411, 37628771, 39736366, 39873160, 8434580	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	BEFREE	17384201, 21216463, 27189701, 28382147, 28858294, 29467487, 29632340, 31427718		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	CTD_human_DG	21917757		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	22078487, 31522431		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	20137830		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	20137830		★☆☆☆☆ Found in Text Mining only
Mycoplasma-Induced Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	33098490	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	28212373, 30877373, 31623402		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	18206726, 19407318	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	22641215, 25828893, 30825668		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	30615982		★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	20561897		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	17225870		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	17225870	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	23040216, 29136949, 29608885, 30041821, 31773708		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	17225870, 33811702	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	23979918, 25872765, 30717758		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	25872765, 26715277	Associate	★☆☆☆☆ Found in Text Mining only
Nausea	Nausea	Pubtator	30080919	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	10373561, 17225870, 20421386, 22532167, 23666923, 23703322, 23722590, 23883585, 24441188, 24832602, 25161998, 26241492, 33811702	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	18305410	Stimulate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	38593154	Inhibit	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10597301, 11781113, 11948969, 12455052, 12707040, 14566854, 15010879, 15142883, 15867241, 16123586, 16810332, 17235304, 18006925, 18059167, 18314489, 18547621, 19568233, 19648052, 20113831, 20127978, 20209601, 20464779, 20561897, 20568893, 21069454, 21109939, 21118481, 21187397, 21224467, 21409392, 21555554, 21571912, 21637635, 21641992, 21775006, 21908496, 21988227, 22015278, 22287547, 22532167, 22596349, 22915751, 22915752, 22965279, 22966016, 22993403, 23087057, 23110154, 23165508, 23275151, 23410825, 23533664, 23656790, 23736962, 23807292, 23957916, 24191958, 24197988, 24240700, 24265759, 24337974, 24473064, 24508840, 24535833, 24694877, 24784564, 24798692, 24874429, 24889936, 25050737, 25268610, 25302833, 25528020, 25583815, 25686825, 25868852, 25883215, 26069190, 26091343, 26215403, 26469962, 26530780, 26577420, 26602448, 26658963, 26661118, 26713604, 26842236, 26881472, 26934368, 27002766, 27188668, 27282964, 27533253, 27559053, 27596623, 27705909, 27884198, 27993965, 27997688, 28034751, 28034904, 28131528, 28169543, 28211448, 28228392, 28314386, 28427225, 28500233, 28510338, 28537893, 28601509, 28619759, 28654422, 28678836, 28692916, 28714367, 28745064, 28747513, 28856922, 28993682, 29063620, 29133592, 29138344, 29152107, 29179487, 29199015, 29254481, 29260919, 29262321, 29332790, 29335205, 29348879, 29393407, 29398485, 29467487, 29509546, 29511347, 29513652, 29530602, 29546393, 29592899, 29606109, 29627078, 29632181, 29664016, 29733524, 29770446, 29855275, 29866945, 29898385, 29917049, 29941481, 29945991, 29955143, 29980753, 30099369, 30333000, 30352801, 30391013, 30400006, 30425037, 30425572, 30470508, 30477538, 30478958, 30487607, 30540933, 30576655, 30589644, 30612738, 30680959, 30681819, 30717758, 30738018, 30760478, 30788663, 30797591, 30864743, 30899378, 31015319, 31029033, 31076742, 31128995, 31131495, 31196855, 31266951, 31320901, 31431131, 31653094, 31679579, 31738050, 31815045, 3759579		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	22244202		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	17222947		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	21859926, 22689924, 25736927, 27599694, 27791127, 28394338, 28830922, 29398485, 29452418, 30034627, 31072830, 31592410, 31676730		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	25563294, 27599694, 32103589, 35217496, 39731187	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	24420784, 34750622	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	25280774, 25881554, 27867042, 28130107, 28302009, 29128369, 29327278, 30390553, 30414941, 30431142, 31754701		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	29872498		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	19604089		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	19604089	Associate	★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	BEFREE	25307738		★☆☆☆☆ Found in Text Mining only
Nijmegen Breakage Syndrome	Nijmegen Breakage Syndrome	BEFREE	22396666, 29874127		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	27979751, 28013023, 30861601		★☆☆☆☆ Found in Text Mining only
Non-obstructive azoospermia	Non-obstructive azoospermia	BEFREE	28853108		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17609380, 20940192, 21420246, 21706479, 23275151, 23428903, 23479135, 23934192, 24191958, 25302833, 26975633, 28460475, 28461256, 28982084, 29133592, 29152062, 29152079, 30076413, 30082520, 30127774, 30466996, 30589644, 31438892, 31753490, 31786739, 31795418		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	21908496		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	CTD_human_DG	20561897		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	23800102		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	32946760, 35417665	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	16827122		★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	25106941		★☆☆☆☆ Found in Text Mining only
Osteogenesis imperfecta type 3	Osteogenesis imperfecta	Pubtator	29976663	Associate	★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	35147204	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	11494111, 12154052, 22940495, 27656839, 29313488, 29784019, 31433581		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	15670817, 27656839, 31433581	Associate	★☆☆☆☆ Found in Text Mining only
Ovalocytosis, Malaysian-Melanesian-Filipino Type	Ovalocytosis	BEFREE	11677271		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	26787835, 28882436, 29684820, 30266954, 30666631		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	29685880		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	21187397, 22180407, 22983827, 23442605, 23675882, 23729402, 24168967, 24448423, 24727989, 24984781, 25589624, 26169965, 26520390, 26774475, 26909613, 27016230, 27065456, 27169997, 27810860, 27884198, 28454085, 28601509, 28643177, 28692638, 28790837, 28933580, 28984489, 29037806, 29081841, 29184090, 29189915, 29254167, 29262611, 29327913, 29352572, 29464354, 29509546, 29512470, 29567272, 29644491, 29684820, 29703482, 29871906, 30177437, 30342021, 30353044, 30540933, 30543930, 30551885, 30555227, 30926640, 31117037, 31303961, 31335830, 31500199, 31591108, 31594824, 31630846, 31722968, 31815769		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20606085, 21521830, 21613406, 22110186, 22180407, 22833573, 23442605, 23729402, 24097829, 24448423, 24554720, 24844596, 25509983, 25865228, 27141070, 27426307, 27614696, 27908594, 27993805, 28073364, 28118040, 28650468, 28882436, 28981112, 29184090, 29189915, 30080919, 30103829, 30318511, 30401718, 30479195, 30576872, 30686551, 30824778, 30889383, 31329989, 31462500, 31594824, 31775908, 32398324, 32594311, 33674744, 33863820, 34572083, 34620163, 34686201, 34861889, 34919531, 35418544, 35419627, 35920396, 36063278, 36142803, 36183837, 36267463, 36364346, 36441795, 36539830, 36601114, 36729997, 36808277, 37525239, 37535879, 37702443, 39456660, 39594596	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35444023, 35921524, 40117291	Inhibit	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36344544	Stimulate	★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	31423128		★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	29490557		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	20931645, 21508395, 23833311, 24534203, 24889936, 25117293, 25864590, 26881472, 28656219, 29434894, 30614530, 30635165, 30681819, 30940721		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	24536047, 25864590, 31002019, 31126889		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	26924195		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	11454803, 22134241, 22850545, 23722537, 25271986, 25333575, 25558828, 26247574, 28346693, 31856090, 32186702, 33214574, 33662100, 34531868, 34854226, 36113257, 38433576	Associate	★☆☆☆☆ Found in Text Mining only
Panniculitis	Panniculitis	BEFREE	31002019		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28086241		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	29636359		★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid neoplasm	Pubtator	36808802	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	15257133, 15672325		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	15672325	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	17362997, 21767974, 29027992, 29062606, 29290984, 30385548, 30974833		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE 2, AUTOSOMAL RECESSIVE JUVENILE	Parkinson Disease	CTD_human_DG	17640816		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	CTD_human_DG	17640816		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonism, Juvenile	Parkinsonian disease	CTD_human_DG	17640816		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	24536047		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	23760440		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	32755612	Associate	★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	22159350		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	37453150	Associate	★☆☆☆☆ Found in Text Mining only
Persistent Hyperplastic Primary Vitreous	Persistent Hyperplastic Primary Vitreous	BEFREE	31462148		★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	BEFREE	24841412, 25532569		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	28698968, 29636359		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	34531868	Associate	★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	19533660		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28257413		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	15142883		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	21224467		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	29367615		★☆☆☆☆ Found in Text Mining only
Primary peritoneal carcinoma	Peritoneal Carcinoma	BEFREE	25818403		★☆☆☆☆ Found in Text Mining only
Profound Mental Retardation	Mental retardation	CTD_human_DG	21937992		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12664070, 15342424, 15868402, 16490787, 18607066, 21571912, 22179663, 22666381, 22993403, 23807292, 24204199, 24239883, 24866151, 25127709, 25173886, 26026052, 26210103, 27169997, 27426307, 27590317, 27596623, 27600766, 27994514, 28323658, 28415632, 28540598, 28583748, 28851861, 29063620, 29138344, 29187880, 29393407, 29465803, 29500400, 29526801, 30195072, 30234108, 30305041, 30478958, 30880062, 31006810, 31060606, 31232159, 31310591, 31796516		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	15342424		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20418896, 21045146, 22624032, 23565244, 23807292, 27426307, 28851861, 29500400, 31006810, 32123273, 32343890, 32427575, 32630281, 33176972, 33608381, 33827356, 34325986, 34388386, 34933951, 35179959, 35457012, 35476551, 35609768, 35701722, 35816343, 36597139, 36622760, 36768364, 37002234, 8434580	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	20551068, 25173886, 29063620, 30996792		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28487881	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prune Belly Syndrome	Prune belly syndrome	BEFREE	29490557		★☆☆☆☆ Found in Text Mining only
Pseudopelade	Pseudopelade	CTD_human_DG	20561897		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	31755591		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	23894640	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	29355504, 30993494		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	27704718		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31164820		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ramsay Hunt Paralysis Syndrome	Ramsay Hunt Paralysis Syndrome	CTD_human_DG	17640816		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	20559012		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	19030862, 19228791		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15144896, 15188008, 24595077, 29435132, 30273566, 31000589		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28224182, 28883608		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	29599129		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	30973576, 31494107		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	34639028	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	23913164	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	23913164, 30357520, 31031007		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	35879366	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Embryonal	Rhabdomyosarcoma	Pubtator	23913164	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12632415, 15082117, 15743888, 15868402, 17890271, 19030862, 19228791, 20665026, 26339143		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	12632415, 15743888		★☆☆☆☆ Found in Text Mining only
Rotator cuff syndrome	Rotator cuff syndrome	BEFREE	28131694		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	11956622		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	21508354, 27643881, 31131495, 36779660, 36929572	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	23966622, 28399901, 28454547, 31131495		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	22460902, 26505995, 27336789, 29358035, 29513652, 31992690	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	22300411	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	36849535	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	31819047		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	12657979		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	17235304		★☆☆☆☆ Found in Text Mining only
Severe combined immunodeficiency due to adenosine deaminase deficiency	Severe combined immunodeficiency	Pubtator	28463527	Inhibit	★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	14632209	Associate	★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	29205518		★☆☆☆☆ Found in Text Mining only
SHORT syndrome	Short syndrome	Pubtator	39596510	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	37408182	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	11533241, 19700606	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	1618343	Stimulate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	22961666, 22969115, 27440269, 27871924, 28212573, 29330466, 29570891, 29862234, 29941481, 29945991, 30203184, 30327308, 30354077, 30760478, 30777870, 31148500, 31215481, 31416802, 31575562		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	22961666	Inhibit	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	25400754, 29570891, 29906251, 31215481, 32767507, 36253561, 37390276, 37395033	Associate	★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	22820987, 22968923, 24556691, 26205471		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22454210, 27644669		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	15205355, 24219164, 26090615, 28789382, 30887517, 31002369, 31396961		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17614107	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17614107, 22882088, 26799421, 27644669, 28257034, 30543656, 34531868, 36006023	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28415784	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	28277882, 29862232		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	26799421, 29416738, 29719599, 31490091		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	28704930		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	27979751		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	28399901, 31131495		★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stevens-Johnson Syndrome Toxic Epidermal Necrolysis Spectrum	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	18716896, 21612407, 22221038, 22374853, 22901183, 23317230, 31174925, 31812083		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21897022, 22901183, 24841718, 26540566, 28000850, 30066897, 31983162, 34531868, 37401238, 37889078	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	11590148, 19087198, 36448327	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29431122		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	34531868	Associate	★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	23613505		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	24956560, 28177666		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	28086241	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	22922830, 22982218, 30183716, 9130606		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	9130606		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	22922830, 22982218, 30183716		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	28086241, 30183716, 36006023	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	30183716	Associate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue Neoplasms	BEFREE	26900125		★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	29240252		★☆☆☆☆ Found in Text Mining only
Transposition of Great Vessels	Transposition Of Great Vessels	BEFREE	29974386		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	21409392		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	20632057, 22678161, 23717600, 23825533, 24420152, 25690937, 26083025, 26261599, 26703669, 27107440, 27472710, 27756336, 29064327, 30589644, 30725116, 31715127, 32080212, 32355298, 32471999, 33832512, 34080025, 34356606, 34880209, 35149538, 38201253, 40723906	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	20664514, 21593597, 22915752, 23110154, 23656790, 23825533, 25202071, 25456381, 25770156, 26261599, 26294743, 26546619, 26577420, 26703669, 26801247, 27626685, 27694903, 27994514, 28034904, 28069724, 28205193, 28235006, 28958991, 29152062, 29180466, 29202431, 29312562, 29696717, 29736741, 30259975, 30289618, 30323975, 30551406, 30580238, 30661659, 30672063, 30725116, 30824588, 30949414, 31015319, 31029033, 31519327, 31551501, 31570423, 31754897		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36990278	Inhibit	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	22166496, 26873485, 27295004, 28433067, 29511347, 34531868, 39726319	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	22454210, 22624032, 23633189, 25594147, 28993682, 34076351, 34531868, 34642300, 35503086	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33188153	Stimulate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	31146482, 31487962		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	33572586, 34531868	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	37679327	Associate	★☆☆☆☆ Found in Text Mining only
Venous Insufficiency	Venous insufficiency	Pubtator	32141705	Associate	★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	12414932		★☆☆☆☆ Found in Text Mining only
Vitamin A Deficiency	Vitamin A Deficiency	CTD_human_DG	18676402		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitiligo	Vitiligo	BEFREE	23369758		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	23369758		★☆☆☆☆ Found in Text Mining only
WARSAW BREAKAGE SYNDROME	Warsaw Breakage Syndrome	BEFREE	25583207		★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	12707040, 14612404, 14734561, 30413344		★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner syndrome	Pubtator	14596914, 14612404, 15292449	Associate	★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	LHGDN	15292449		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma pigmentosum	Pubtator	23038248, 33495403	Associate	★☆☆☆☆ Found in Text Mining only
Xeroderma pigmentosum, group A	Xeroderma Pigmentosum	BEFREE	26880244, 28552776		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

PARP2 7 shared pathwaysBase excision repair, Apoptosis, POLB-Dependent Long Patch Base Excision Repair, HDR through MMEJ (alt-NHEJ), DNA Damage Recognition in GG-NER, Formation of Incision Complex in GG-NER, Dual Incision in GG-NER Related via 7 shared pathways including Base excision repair, Apoptosis. GREM1 5 shared diseasesCancer, Colorectal neoplasms, Estrogen-receptor negative breast cancer, Ovarian serous carcinoma, Pulmonary fibrosis 6 shared evidence sourcesGWAS catalog (Cancer), CTD (Colorectal neoplasms), GWAS catalog (Estrogen-receptor negative breast cancer), GWAS catalog (Ovarian serous carcinoma), CTD (Pulmonary fibrosis), Disgenet (Pulmonary fibrosis) Related via 5 shared diseases including Cancer, Colorectal neoplasms — evidence mostly GWAS catalog. CCL3 4 shared diseasesAtherosclerosis, Brain ischemia, Mesothelioma, Pulmonary fibrosis 7 shared evidence sourcesCTD (Atherosclerosis), Disgenet (Atherosclerosis), CTD (Brain ischemia), Disgenet (Brain ischemia), CTD (Mesothelioma), CTD (Pulmonary fibrosis), Disgenet (Pulmonary fibrosis) Related via 4 shared diseases including Atherosclerosis, Brain ischemia — evidence mostly CTD. CCHCR1 5 shared diseasesCancer, Estrogen-receptor negative breast cancer, Multiple myeloma, Myeloproliferative disorder, Ovarian serous carcinoma 4 shared evidence sourcesGWAS catalog (Cancer), GWAS catalog (Estrogen-receptor negative breast cancer), GWAS catalog (Myeloproliferative disorder), GWAS catalog (Ovarian serous carcinoma) Related via 5 shared diseases including Cancer, Estrogen-receptor negative breast cancer — evidence mostly GWAS catalog. IL4 4 shared diseasesCardiomyopathy, Dermatitis, Mesothelioma, Pulmonary fibrosis 11 shared evidence sourcesDisgenet (Alzheimer disease), Disgenet (Ankylosing spondylitis), Disgenet (Asthma), CTD (Asthma), Disgenet (Cardiomyopathy), CTD (Cardiomyopathy), Disgenet (Dermatitis), CTD (Dermatitis), CTD (Mesothelioma), CTD (Pulmonary fibrosis), Disgenet (Pulmonary fibrosis) Related via 4 shared diseases including Cardiomyopathy, Dermatitis — evidence mostly Disgenet.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PARP2	0	[]	7	["Base excision repair","Apoptosis","POLB-Dependent Long Patch Base Excision Repair","HDR through MMEJ (alt-NHEJ)","DNA Damage Recognition in GG-NER","Formation of Incision Complex in GG-NER","Dual Incision in GG-NER"]	0	[]
GREM1	5	["Cancer","Colorectal neoplasms","Estrogen-receptor negative breast cancer","Ovarian serous carcinoma","Pulmonary fibrosis"]	0	[]	6	["GWAS catalog (Cancer)","CTD (Colorectal neoplasms)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Ovarian serous carcinoma)","CTD (Pulmonary fibrosis)","Disgenet (Pulmonary fibrosis)"]
CCL3	4	["Atherosclerosis","Brain ischemia","Mesothelioma","Pulmonary fibrosis"]	0	[]	7	["CTD (Atherosclerosis)","Disgenet (Atherosclerosis)","CTD (Brain ischemia)","Disgenet (Brain ischemia)","CTD (Mesothelioma)","CTD (Pulmonary fibrosis)","Disgenet (Pulmonary fibrosis)"]
CCHCR1	5	["Cancer","Estrogen-receptor negative breast cancer","Multiple myeloma","Myeloproliferative disorder","Ovarian serous carcinoma"]	0	[]	4	["GWAS catalog (Cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Myeloproliferative disorder)","GWAS catalog (Ovarian serous carcinoma)"]
IL4	4	["Cardiomyopathy","Dermatitis","Mesothelioma","Pulmonary fibrosis"]	0	[]	11	["Disgenet (Alzheimer disease)","Disgenet (Ankylosing spondylitis)","Disgenet (Asthma)","CTD (Asthma)","Disgenet (Cardiomyopathy)","CTD (Cardiomyopathy)","Disgenet (Dermatitis)","CTD (Dermatitis)","CTD (Mesothelioma)","CTD (Pulmonary fibrosis)","Disgenet (Pulmonary fibrosis)"]

Diseases Linked via Similar Genes

Hypersensitivity Linked via 2 of 5 related genesCCL3, IL4 Psoriasis Linked via 2 of 5 related genesCCHCR1, IL4 Systemic lupus erythematosus Linked via 2 of 5 related genesCCHCR1, IL4 Lipodystrophy Linked via 1 of 5 related genesPARP2 Neoplasms Linked via 1 of 5 related genesGREM1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Hypersensitivity	2	["CCL3","IL4"]
Psoriasis	2	["CCHCR1","IL4"]
Systemic lupus erythematosus	2	["CCHCR1","IL4"]
Lipodystrophy	1	["PARP2"]
Neoplasms	1	["GREM1"]