OXT (oxytocin/neurophysin I prepropeptide)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 5020
• Gene name: Oxytocin/neurophysin I prepropeptide
• Gene symbol: OXT
• Synonyms (NCBI Gene): OT, OT-NPI, OXT-NPI
• Chromosome: 20
• Chromosome location: 20p13
• Summary: This gene encodes a precursor protein that is processed to produce oxytocin and neurophysin I. Oxytocin is a posterior pituitary hormone which is synthesized as an inactive precursor in the hypothalamus along with its carrier protein neurophysin I. Togeth

Transcription factors

Transcription factor	Regulation	Reference
ESR1	Unknown	10411324
ESR2	Unknown	10411324
NR2C2	Unknown	17054912

Gene ontology (GO) Show/Hide all (63)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001975	Process	Response to amphetamine	IEA
GO:0002027	Process	Regulation of heart rate	IEA
GO:0002125	Process	Maternal aggressive behavior	IBA
GO:0002125	Process	Maternal aggressive behavior	IEA
GO:0005179	Function	Hormone activity	IEA
GO:0005184	Function	Neuropeptide hormone activity	IBA
GO:0005184	Function	Neuropeptide hormone activity	IEA
GO:0005185	Function	Neurohypophyseal hormone activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0007165	Process	Signal transduction	TAS	10218979
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007507	Process	Heart development	IEA
GO:0007565	Process	Female pregnancy	IEA
GO:0007613	Process	Memory	IEA
GO:0007625	Process	Grooming behavior	IEA
GO:0009744	Process	Response to sucrose	IEA
GO:0010701	Process	Positive regulation of norepinephrine secretion	IEA
GO:0014823	Process	Response to activity	IEA
GO:0030141	Component	Secretory granule	IBA
GO:0030141	Component	Secretory granule	IEA
GO:0031855	Function	Oxytocin receptor binding	IBA
GO:0031855	Function	Oxytocin receptor binding	IEA
GO:0032094	Process	Response to food	IEA
GO:0032308	Process	Positive regulation of prostaglandin secretion	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0032526	Process	Response to retinoic acid	IEA
GO:0032570	Process	Response to progesterone	IEA
GO:0033595	Process	Response to genistein	IEA
GO:0034695	Process	Response to prostaglandin E	IEA
GO:0035176	Process	Social behavior	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035811	Process	Negative regulation of urine volume	IEA
GO:0042220	Process	Response to cocaine	IEA
GO:0042711	Process	Maternal behavior	IEA
GO:0042713	Process	Sperm ejaculation	IEA
GO:0042755	Process	Eating behavior	IEA
GO:0042756	Process	Drinking behavior	IEA
GO:0043195	Component	Terminal bouton	IEA
GO:0043434	Process	Response to peptide hormone	IEA
GO:0045472	Process	Response to ether	IEA
GO:0045776	Process	Negative regulation of blood pressure	IEA
GO:0045777	Process	Positive regulation of blood pressure	IEA
GO:0045778	Process	Positive regulation of ossification	IEA
GO:0045925	Process	Positive regulation of female receptivity	IEA
GO:0048545	Process	Response to steroid hormone	IEA
GO:0050806	Process	Positive regulation of synaptic transmission	IEA
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0051591	Process	Response to cAMP	IEA
GO:0051602	Process	Response to electrical stimulus	IEA
GO:0051965	Process	Positive regulation of synapse assembly	IEA
GO:0060179	Process	Male mating behavior	IEA
GO:0060406	Process	Positive regulation of penile erection	IEA
GO:0060450	Process	Positive regulation of hindgut contraction	IEA
GO:0070474	Process	Positive regulation of uterine smooth muscle contraction	IBA
GO:0070474	Process	Positive regulation of uterine smooth muscle contraction	IEA
GO:0098992	Component	Neuronal dense core vesicle	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	18071238

Other IDs

• MIM: 167050
• HGNC: 8528
• e!Ensembl: ENSG00000101405

Protein

• UniProt ID: P01178
• Protein name: Oxytocin-neurophysin 1 (OT-NPI) [Cleaved into: Oxytocin (Ocytocin); Neurophysin 1]
• Protein function: Neurophysin 1 specifically binds oxytocin.; Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Acts by binding to oxytocin receptor (OXTR) (PubMed:18174156).
• PDB: 7OFG , 7OTD , 7QVM , 7RYC
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00220	Hormone_4	20 → 28	Neurohypophysial hormones, N-terminal Domain	Family
  PF00184	Hormone_5	39 → 116	Neurohypophysial hormones, C-terminal Domain	Family

• Sequence:

  MAGPSLACCLLGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCA
  EELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEA
  TFSQR

• Sequence length: 125

Pathways

KEGG Pathway	Reactome Pathway
cAMP signaling pathway	Vasopressin-like receptors
Neuroactive ligand-receptor interaction	G alpha (q) signalling events
Hormone signaling
Oxytocin signaling pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (25)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ANXIETY DISORDERS	—	CTD, Disgenet CTD, Disgenet	19228979	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	15288368	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	8647655	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	8647655	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISSEMINATED INTRAVASCULAR COAGULATION	—	CTD, Disgenet CTD, Disgenet	15547535	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EDEMA	—	CTD	5067144, 5538905	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY, TONIC-CLONIC	—	CTD	4988877, 6407273	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEADACHE	—	CTD	7080326	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIS	—	CTD	18092152	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	18562099, 9334988	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	11171655	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental disorder	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC DISEASES	—	CTD, Disgenet CTD, Disgenet	17492653	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	19397503, 292422, 3923190, 5067144, 5493616, 644406	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TONIC-CLONIC EPILEPSY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WATER INTOXICATION	—	CTD, Disgenet CTD, Disgenet	292422, 3923190, 4988877, 5067144, 5493616, 5528113, 7360068, 803783	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (113)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	31775875	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	31775875		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	36495857	Associate	★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	8647655		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	28616820		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia nervosa	Pubtator	24523928	Associate	★☆☆☆☆ Found in Text Mining only
Anovulation	Anovulation	Pubtator	37013781	Associate	★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial personality disorder	Pubtator	27036876, 29927293	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	22418012, 23413037, 25262417, 26615966, 27903255, 35462200	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	26741286, 28371242, 29410310, 31252303	Inhibit	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	CTD_human_DG	19228979		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety Disorders	Anxiety disorder	Pubtator	25262417, 33582574	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety States, Neurotic	Anxiety Disorder	CTD_human_DG	19228979		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	18940936	Inhibit	★☆☆☆☆ Found in Text Mining only
Attention Deficit and Disruptive Behavior Disorders	Attention deficit hyperactivity disorder	Pubtator	21702900	Inhibit	★☆☆☆☆ Found in Text Mining only
Attention Deficit and Disruptive Behavior Disorders	Attention deficit hyperactivity disorder	Pubtator	26178189	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	26506050, 38066446	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	23413037, 27552585	Inhibit	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	24634087, 25092315, 27798253, 28577550, 29309996, 31530830, 31931508, 32398642, 32777383, 33622389, 34091402, 34301983, 35316293, 35665681, 37391413, 38167302, 38402445, 39395443	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	26788924, 28283809, 30514927		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CTD_human_DG	15288368, 18775368		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	LHGDN	17137561		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	19845973, 23284802, 24485488, 26371313, 26506050, 27798253, 28418398, 31530830, 31827587, 32398642, 33081830, 33622389, 35316293, 35545057, 37391413, 38167302	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	24086383	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	24558199, 31214061		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autonomic Nervous System Diseases	Autonomic nervous system disease	Pubtator	22257050	Associate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	26406593	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	29684488, 29940428, 34824196	Associate	★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	Pubtator	25102084, 37771092	Associate	★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	Pubtator	26506050	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22653497		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16596243, 16778082, 33742056, 35564499, 8669475	Associate	★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	31005045	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	8647655		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36153509, 36346805	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	31005045	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	8647655		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	37243441	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Restrictive	Restrictive cardiomyopathy	Pubtator	27862641	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	34824196	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	29596446	Associate	★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	19397503, 292422, 3923190, 5067144, 5493616, 644406		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	23284802, 40120166	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	8647655		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Complex partial seizures	Seizure	CTD_human_DG	19397503, 292422, 3923190, 5067144, 5493616, 644406		★☆☆☆☆ Found in Text Mining only
Conduct Disorder	Conduct Disorder	BEFREE	28478728		★☆☆☆☆ Found in Text Mining only
Cryptogenic Tonic-Clonic Epilepsy	Cryptogenic Tonic-Clonic Epilepsy	CTD_human_DG	4988877, 6407273		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	31775875		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	22088430, 23846912, 23941164, 24025838, 25025656		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	23941164		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	28447621, 33582574	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	29940428	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	35505296	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Insipidus Neurogenic	Neurogenic diabetes insipidus	Pubtator	28597171	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	22997507, 34824196	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37400893	Inhibit	★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	CTD_human_DG	15547535		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	21816851	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	31273584	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	37628589	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Tonic-Clonic, Familial	Epilepsy	CTD_human_DG	4988877, 6407273		★☆☆☆☆ Found in Text Mining only
Epilepsy, Tonic-Clonic, Symptomatic	Epilepsy	CTD_human_DG	4988877, 6407273		★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	19397503, 292422, 3923190, 5067144, 5493616, 644406		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	30261917, 32963103, 36495857	Associate	★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	19397503, 292422, 3923190, 5067144, 5493616, 644406		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22252786	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	37243441	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	16596243	Associate	★☆☆☆☆ Found in Text Mining only
Holoprosencephaly	Holoprosencephaly	Pubtator	21832120	Associate	★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	Pubtator	37013781	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	38042639	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	18562099, 9334988		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypopituitarism	Hypopituitarism	Pubtator	28597171	Inhibit	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	20711752	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	19943975		★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	19397503, 292422, 3923190, 5067144, 5493616, 644406		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	20056210	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	36346805	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	8293425	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	PSYGENET_DG	19500216, 19515497, 21208749		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	22653497		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	8647655		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	19500216, 23941164		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	22088430, 23846912, 23941164, 24025838, 25025656		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome	Metabolic syndrome	Pubtator	34824196	Associate	★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	PSYGENET_DG	20547007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood disorder	Pubtator	28447621	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopathy Central Core	Central core myopathy	Pubtator	33622389	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	22252786	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28447621		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31089364		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	29501452		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23653389, 27886242, 29596446, 33809270, 37013781	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	18384894		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26935408, 31005045	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31919036	Associate	★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	31775875		★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic Diseases	CTD_human_DG	17492653		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20663860, 30078221	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28415720	Stimulate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	29940428, 35688807, 37373400	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20196918, 22651577, 31024366		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	20196918, 21899794, 21962914, 22651577, 23284802		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	21899794, 23284802, 29940428, 34824196	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Single Seizure	Seizure	CTD_human_DG	19397503, 292422, 3923190, 5067144, 5493616, 644406		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	15613460, 1702222	Associate	★☆☆☆☆ Found in Text Mining only
Taste Disorders	Taste Disorders	CTD_human_DG	7080326		★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	CTD_human_DG	19397503, 292422, 3923190, 5067144, 5493616, 644406		★☆☆☆☆ Found in Text Mining only
Tonic-Clonic Epilepsy	Tonic-Clonic Epilepsy	CTD_human_DG	4988877, 6407273		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	8647655		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	19500216, 19515497, 21208749		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Visual seizure	Seizure	CTD_human_DG	19397503, 292422, 3923190, 5067144, 5493616, 644406		★☆☆☆☆ Found in Text Mining only
Williams Syndrome	Williams syndrome	Pubtator	22719898, 28424317	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

OXTR 1 shared diseaseDepression 5 shared pathwayscAMP signaling pathway, Hormone signaling, Oxytocin signaling pathway, G alpha (q) signalling events, Vasopressin-like receptors 1 shared evidence sourceDisgenet (Depression) Related via 5 shared pathways including cAMP signaling pathway, Hormone signaling — evidence mostly Disgenet. CRHR1 4 shared diseasesAnxiety disorder, Depression, Mood disorder, Hyperkinesia 2 shared pathwayscAMP signaling pathway, Hormone signaling 6 shared evidence sourcesDisgenet (Anxiety disorder), CTD (Anxiety disorder), Disgenet (Depression), Disgenet (Mood disorder), Disgenet (Hyperkinesia), CTD (Hyperkinesia) Related via 4 shared diseases including Anxiety disorder, Depression — evidence mostly Disgenet. ADRA1B 3 shared diseasesMood disorder, Seizures, Hypotension 2 shared pathwaysHormone signaling, G alpha (q) signalling events 3 shared evidence sourcesDisgenet (Mood disorder), CTD (Hypotension), CTD (Seizures) Related via 3 shared diseases including Mood disorder, Seizures — evidence mostly CTD. DRD1 4 shared diseasesDepression, Seizures, Hyperkinesia, Hypotension 2 shared pathwayscAMP signaling pathway, Hormone signaling 5 shared evidence sourcesDisgenet (Depression), Disgenet (Hyperkinesia), CTD (Hyperkinesia), CTD (Hypotension), CTD (Seizures) Related via 4 shared diseases including Depression, Seizures — evidence mostly CTD. ADORA2A 5 shared diseasesAnxiety disorder, Mood disorder, Seizures, Hyperkinesia, Hypotension 1 shared pathwaycAMP signaling pathway 7 shared evidence sourcesDisgenet (Anxiety disorder), CTD (Anxiety disorder), Disgenet (Mood disorder), Disgenet (Hyperkinesia), CTD (Hyperkinesia), CTD (Hypotension), CTD (Seizures) Related via 5 shared diseases including Anxiety disorder, Mood disorder — evidence mostly CTD.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
OXTR	1	["Depression"]	5	["cAMP signaling pathway","Hormone signaling","Oxytocin signaling pathway","G alpha (q) signalling events","Vasopressin-like receptors"]	1	["Disgenet (Depression)"]
CRHR1	4	["Anxiety disorder","Depression","Mood disorder","Hyperkinesia"]	2	["cAMP signaling pathway","Hormone signaling"]	6	["Disgenet (Anxiety disorder)","CTD (Anxiety disorder)","Disgenet (Depression)","Disgenet (Mood disorder)","Disgenet (Hyperkinesia)","CTD (Hyperkinesia)"]
ADRA1B	3	["Mood disorder","Seizures","Hypotension"]	2	["Hormone signaling","G alpha (q) signalling events"]	3	["Disgenet (Mood disorder)","CTD (Hypotension)","CTD (Seizures)"]
DRD1	4	["Depression","Seizures","Hyperkinesia","Hypotension"]	2	["cAMP signaling pathway","Hormone signaling"]	5	["Disgenet (Depression)","Disgenet (Hyperkinesia)","CTD (Hyperkinesia)","CTD (Hypotension)","CTD (Seizures)"]
ADORA2A	5	["Anxiety disorder","Mood disorder","Seizures","Hyperkinesia","Hypotension"]	1	["cAMP signaling pathway"]	7	["Disgenet (Anxiety disorder)","CTD (Anxiety disorder)","Disgenet (Mood disorder)","Disgenet (Hyperkinesia)","CTD (Hyperkinesia)","CTD (Hypotension)","CTD (Seizures)"]

Diseases Linked via Similar Genes

Cardiomyopathy Linked via 2 of 5 related genesOXTR, ADORA2A Asthma Linked via 2 of 5 related genesCRHR1, ADORA2A Bipolar disorder Linked via 2 of 5 related genesCRHR1, DRD1 Obesity Linked via 2 of 5 related genesCRHR1, DRD1 Amphetamine or sympathomimetic abuse Linked via 2 of 5 related genesDRD1, ADORA2A

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Cardiomyopathy	2	["OXTR","ADORA2A"]
Asthma	2	["CRHR1","ADORA2A"]
Bipolar disorder	2	["CRHR1","DRD1"]
Obesity	2	["CRHR1","DRD1"]
Amphetamine or sympathomimetic abuse	2	["DRD1","ADORA2A"]