ADRA1B (adrenoceptor alpha 1B)

Gene

• Entrez ID: 147
• Gene name: Adrenoceptor alpha 1B
• Gene symbol: ADRA1B
• Synonyms (NCBI Gene): ADRA1, ALPHA1BAR
• Chromosome: 5
• Chromosome location: 5q33.3
• Summary: Alpha-1-adrenergic receptors (alpha-1-ARs) are members of the G protein-coupled receptor superfamily. They activate mitogenic responses and regulate growth and proliferation of many cells. There are 3 alpha-1-AR subtypes: alpha-1A, -1B and -1D, all of whi

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT047408	hsa-miR-10b-5p	CLASH	23622248
MIRT769805	hsa-miR-224	CLIP-seq
MIRT2470514	hsa-miR-3155	CLIP-seq
MIRT2470515	hsa-miR-3155b	CLIP-seq
MIRT2470516	hsa-miR-361-3p	CLIP-seq
MIRT2470517	hsa-miR-4467	CLIP-seq
MIRT2470518	hsa-miR-484	CLIP-seq
MIRT2470514	hsa-miR-3155	CLIP-seq
MIRT2470515	hsa-miR-3155b	CLIP-seq
MIRT2470516	hsa-miR-361-3p	CLIP-seq
MIRT2470517	hsa-miR-4467	CLIP-seq
MIRT2470518	hsa-miR-484	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004935	Function	Adrenergic receptor activity	IEA
GO:0004937	Function	Alpha1-adrenergic receptor activity	IBA
GO:0004937	Function	Alpha1-adrenergic receptor activity	IEA
GO:0004937	Function	Alpha1-adrenergic receptor activity	TAS	1328250
GO:0005515	Function	Protein binding	IPI	24567387
GO:0005634	Component	Nucleus	IDA	22120526
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	24567387
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	24567387
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	1328250
GO:0005901	Component	Caveola	IEA
GO:0006937	Process	Regulation of muscle contraction	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	2154750
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	TAS	10820200
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0007267	Process	Cell-cell signaling	IBA
GO:0007267	Process	Cell-cell signaling	TAS	1328250
GO:0016020	Component	Membrane	IEA
GO:0019229	Process	Regulation of vasoconstriction	IEA
GO:0031965	Component	Nuclear membrane	IDA	22120526
GO:0031965	Component	Nuclear membrane	IEA
GO:0035556	Process	Intracellular signal transduction	TAS	10820200
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	22120526
GO:0046982	Function	Protein heterodimerization activity	IDA	22120526
GO:0055117	Process	Regulation of cardiac muscle contraction	IEA
GO:0071880	Process	Adenylate cyclase-activating adrenergic receptor signaling pathway	IBA
GO:0150099	Process	Neuron-glial cell signaling	ISS

Other IDs

• MIM: 104220
• HGNC: 278
• e!Ensembl: ENSG00000170214

Protein

• UniProt ID: P35368
• Protein name: Alpha-1B adrenergic receptor (Alpha-1B adrenoreceptor) (Alpha-1B adrenoceptor)
• Protein function: This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regu
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	62 → 348	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAI
  VGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDI
  WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
  LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
  VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
  GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFV
  RILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRT
  LPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLT
  EPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF

• Sequence length: 520

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Asthma	Asthma	BEFREE	19910028		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	21368917	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	23052569		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	31452791		★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	19125850		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17242706		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17242706	Associate	★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	CTD_human_DG	19125850		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	37679988	Associate	★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	19125850		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	10525102		★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	19125850		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	9915474	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	22615923	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	10525102, 22615923		★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	19125850		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	CTD_human_DG	18257748		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	LHGDN	18257748		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	1337829, 29138825		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	1337829		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	38066059	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17242706		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	PSYGENET_DG	16526032		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	17242706		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	34720019	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	30785334		★☆☆☆☆ Found in Text Mining only
Single Seizure	Seizure	CTD_human_DG	19125850		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17242706, 31452791		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17242706	Inhibit	★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	CTD_human_DG	19125850		★☆☆☆☆ Found in Text Mining only
Visual seizure	Seizure	CTD_human_DG	19125850		★☆☆☆☆ Found in Text Mining only