Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	79625
Gene name	Neuron derived neurotrophic factor
Gene symbol	NDNF
Synonyms (NCBI Gene)	C4orf31HH25NORD
Chromosome	4
Chromosome location	4q27

116 Show/Hide all (116)

miRTarBase ID	miRNA	Experiments	Reference
MIRT655970	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT655969	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT655968	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT655967	hsa-miR-3183	HITS-CLIP	23824327
MIRT655966	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT655964	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT655965	hsa-miR-4662a-5p	HITS-CLIP	23824327
MIRT655963	hsa-miR-1260a	HITS-CLIP	23824327
MIRT655962	hsa-miR-1260b	HITS-CLIP	23824327
MIRT655961	hsa-miR-578	HITS-CLIP	23824327
MIRT655960	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT527999	hsa-miR-4714-5p	PAR-CLIP	22012620
MIRT527998	hsa-miR-146a-3p	PAR-CLIP	22012620
MIRT527997	hsa-miR-4670-3p	PAR-CLIP	22012620
MIRT527996	hsa-miR-6715b-3p	PAR-CLIP	22012620
MIRT527995	hsa-miR-452-3p	PAR-CLIP	22012620
MIRT527994	hsa-miR-6844	PAR-CLIP	22012620
MIRT527993	hsa-miR-607	PAR-CLIP	22012620
MIRT527992	hsa-miR-1305	PAR-CLIP	22012620
MIRT527991	hsa-miR-335-3p	PAR-CLIP	22012620
MIRT445363	hsa-miR-224-3p	PAR-CLIP	22100165
MIRT445362	hsa-miR-522-3p	PAR-CLIP	22100165
MIRT445361	hsa-miR-6507-5p	PAR-CLIP	22100165
MIRT445359	hsa-miR-4635	PAR-CLIP	22100165
MIRT445360	hsa-miR-3185	PAR-CLIP	22100165
MIRT445358	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT445363	hsa-miR-224-3p	PAR-CLIP	22100165
MIRT445362	hsa-miR-522-3p	PAR-CLIP	22100165
MIRT445361	hsa-miR-6507-5p	PAR-CLIP	22100165
MIRT445359	hsa-miR-4635	PAR-CLIP	22100165
MIRT445360	hsa-miR-3185	PAR-CLIP	22100165
MIRT445358	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT655970	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT655969	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT655968	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT655967	hsa-miR-3183	HITS-CLIP	23824327
MIRT655966	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT655964	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT655965	hsa-miR-4662a-5p	HITS-CLIP	23824327
MIRT655963	hsa-miR-1260a	HITS-CLIP	23824327
MIRT655962	hsa-miR-1260b	HITS-CLIP	23824327
MIRT655961	hsa-miR-578	HITS-CLIP	23824327
MIRT655960	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT527999	hsa-miR-4714-5p	PAR-CLIP	22012620
MIRT527998	hsa-miR-146a-3p	PAR-CLIP	22012620
MIRT527997	hsa-miR-4670-3p	PAR-CLIP	22012620
MIRT527996	hsa-miR-6715b-3p	PAR-CLIP	22012620
MIRT527995	hsa-miR-452-3p	PAR-CLIP	22012620
MIRT527994	hsa-miR-6844	PAR-CLIP	22012620
MIRT527993	hsa-miR-607	PAR-CLIP	22012620
MIRT527992	hsa-miR-1305	PAR-CLIP	22012620
MIRT527991	hsa-miR-335-3p	PAR-CLIP	22012620
MIRT445363	hsa-miR-224-3p	PAR-CLIP	22100165
MIRT445362	hsa-miR-522-3p	PAR-CLIP	22100165
MIRT445361	hsa-miR-6507-5p	PAR-CLIP	22100165
MIRT445359	hsa-miR-4635	PAR-CLIP	22100165
MIRT445360	hsa-miR-3185	PAR-CLIP	22100165
MIRT445358	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT445363	hsa-miR-224-3p	PAR-CLIP	22100165
MIRT445362	hsa-miR-522-3p	PAR-CLIP	22100165
MIRT445361	hsa-miR-6507-5p	PAR-CLIP	22100165
MIRT445359	hsa-miR-4635	PAR-CLIP	22100165
MIRT445360	hsa-miR-3185	PAR-CLIP	22100165
MIRT445358	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT1178048	hsa-miR-1206	CLIP-seq
MIRT1178049	hsa-miR-139-5p	CLIP-seq
MIRT1178050	hsa-miR-3125	CLIP-seq
MIRT1178051	hsa-miR-3168	CLIP-seq
MIRT1178052	hsa-miR-33a	CLIP-seq
MIRT1178053	hsa-miR-33b	CLIP-seq
MIRT1178054	hsa-miR-3690	CLIP-seq
MIRT1178055	hsa-miR-3916	CLIP-seq
MIRT1178056	hsa-miR-4254	CLIP-seq
MIRT1178057	hsa-miR-4653-3p	CLIP-seq
MIRT1178058	hsa-miR-4790-3p	CLIP-seq
MIRT1178059	hsa-miR-4797-5p	CLIP-seq
MIRT1178060	hsa-miR-513a-3p	CLIP-seq
MIRT2438966	hsa-miR-1324	CLIP-seq
MIRT2438967	hsa-miR-4711-5p	CLIP-seq
MIRT1178052	hsa-miR-33a	CLIP-seq
MIRT1178053	hsa-miR-33b	CLIP-seq
MIRT2454964	hsa-miR-4265	CLIP-seq
MIRT2454965	hsa-miR-4296	CLIP-seq
MIRT2454966	hsa-miR-4322	CLIP-seq
MIRT2454967	hsa-miR-4455	CLIP-seq
MIRT2454968	hsa-miR-609	CLIP-seq
MIRT1178052	hsa-miR-33a	CLIP-seq
MIRT1178053	hsa-miR-33b	CLIP-seq
MIRT2454964	hsa-miR-4265	CLIP-seq
MIRT2454965	hsa-miR-4296	CLIP-seq
MIRT2454966	hsa-miR-4322	CLIP-seq
MIRT2454967	hsa-miR-4455	CLIP-seq
MIRT2454968	hsa-miR-609	CLIP-seq
MIRT2438966	hsa-miR-1324	CLIP-seq
MIRT2579067	hsa-miR-205	CLIP-seq
MIRT2579068	hsa-miR-335	CLIP-seq
MIRT2579069	hsa-miR-3675-5p	CLIP-seq
MIRT2579070	hsa-miR-4704-5p	CLIP-seq
MIRT2438967	hsa-miR-4711-5p	CLIP-seq
MIRT2579071	hsa-miR-4773	CLIP-seq
MIRT2579072	hsa-miR-486-3p	CLIP-seq
MIRT2579073	hsa-miR-603	CLIP-seq
MIRT2438966	hsa-miR-1324	CLIP-seq
MIRT2579067	hsa-miR-205	CLIP-seq
MIRT2686018	hsa-miR-329	CLIP-seq
MIRT2579068	hsa-miR-335	CLIP-seq
MIRT2686019	hsa-miR-362-3p	CLIP-seq
MIRT2579069	hsa-miR-3675-5p	CLIP-seq
MIRT2686020	hsa-miR-3941	CLIP-seq
MIRT2686021	hsa-miR-410	CLIP-seq
MIRT2579070	hsa-miR-4704-5p	CLIP-seq
MIRT2438967	hsa-miR-4711-5p	CLIP-seq
MIRT2579071	hsa-miR-4773	CLIP-seq
MIRT2686022	hsa-miR-4789-5p	CLIP-seq
MIRT2579072	hsa-miR-486-3p	CLIP-seq
MIRT2579073	hsa-miR-603	CLIP-seq

30 Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IDA	24706764
GO:0001764	Process	Neuron migration	IDA	20969804
GO:0002931	Process	Response to ischemia	IEA
GO:0005539	Function	Glycosaminoglycan binding	IEA
GO:0005539	Function	Glycosaminoglycan binding	ISS
GO:0005576	Component	Extracellular region	IDA	20969804
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	35037619
GO:0005615	Component	Extracellular space	IDA	31883645
GO:0007263	Process	Nitric oxide mediated signal transduction	IDA	24706764
GO:0007399	Process	Nervous system development	IEA
GO:0008201	Function	Heparin binding	IBA
GO:0008201	Function	Heparin binding	IEA
GO:0008201	Function	Heparin binding	ISS
GO:0010811	Process	Positive regulation of cell-substrate adhesion	IEA
GO:0010811	Process	Positive regulation of cell-substrate adhesion	ISS
GO:0010976	Process	Positive regulation of neuron projection development	IDA	20969804
GO:0021828	Process	Gonadotrophin-releasing hormone neuronal migration to the hypothalamus	IEA
GO:0021828	Process	Gonadotrophin-releasing hormone neuronal migration to the hypothalamus	ISS
GO:0030198	Process	Extracellular matrix organization	IBA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0030198	Process	Extracellular matrix organization	ISS
GO:0031012	Component	Extracellular matrix	IEA
GO:0031012	Component	Extracellular matrix	ISS
GO:0043524	Process	Negative regulation of neuron apoptotic process	IDA	20969804
GO:0044344	Process	Cellular response to fibroblast growth factor stimulus	IMP	31883645
GO:0061042	Process	Vascular wound healing	IEA
GO:0061042	Process	Vascular wound healing	ISS
GO:0071456	Process	Cellular response to hypoxia	IDA	24706764
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IDA	24706764

MIM	HGNC	e!Ensembl
616506	26256	ENSG00000173376

Q8TB73

Protein name

Protein NDNF (Neuron-derived neurotrophic factor)

Protein function

Secretory protein that plays a role in various cellular processes (PubMed:20969804, PubMed:24706764, PubMed:31883645). Acts as a chemorepellent acting on gonadotropin-releasing hormone (GnRH) expressing neurons regulating their migration to the

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10179	DUF2369	291 → 383	Uncharacterised conserved protein (DUF2369)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in neurons along the gonadotropin-releasing hormone (GnRH) expressing neurons migratory route. {ECO:0000269|PubMed:31883645}.

Sequence

MVLLHWCLLWLLFPLSSRTQKLPTRDEELFQMQIRDKAFFHDSSVIPDGAEISSYLFRDT
PKRYFFVVEEDNTPLSVTVTPCDAPLEWKLSLQELPEDRSGEGSGDLEPLEQQKQQIINE
EGTELFSYKGNDVEYFISSSSPSGLYQLDLLSTEKDTHFKVYATTTPESDQPYPELPYDP
RVDVTSLGRTTVTLAWKPSPTASLLKQPIQYCVVINKEHNFKSLCAVEAKLSADDAFMMA
PKPGLDFSPFDFAHFGFPSDNSGKERSFQAKPSPKLGRHVYSRPKVDIQKICIGNKNIFT
VSDLKPDTQYYFDVFVVNINSNMSTAYVGTFARTKEEAKQKTVELKDGKITDVFVKRKGA
KFLRFAPVSSHQKVTFFIHSCLDAVQIQVRRDGKLLLSQNVEGIQQFQLRGKPKAKYLVR
LKGNKKGASMLKILATTRPTKQSFPSLPEDTRIKAFDKLRTCSSATVAWLGTQERNKFCI
YKKEVDDNYNEDQKKREQNQCLGPDIRKKSEKVLCKYFHSQNLQKAVTTETIKGLQPGKS
YLLDVYVIGHGGHSVKYQSKVVKTRKFC

Sequence length

568

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Hypogonadotropic hypogonadism 25 with anosmia	Likely pathogenic; Pathogenic	rs2476439283, rs1727077385, rs1726901153, rs1726871489	RCV002290153 RCV001034704 RCV001034705 RCV001034706	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (11)
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	20864642	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGONADOTROPIC HYPOGONADISM	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOPITUITARISM	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC GROWTH HORMONE DEFICIENCY	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KALLMANN SYNDROME	—	CTD, Disgenet, Orphanet CTD, Disgenet, Orphanet CTD, Disgenet, Orphanet	31883645, 31883645	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	40465716	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANHYPOPITUITARISM	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PITUITARY DWARFISM	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PITUITARY SHORT STATURE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SHEEHAN SYNDROME	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (13)
cervical cancer	Cervical Cancer	BEFREE	29572178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29572178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30867731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36092962	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	20864642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	20864642		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Germ cell tumor	Tumor	BEFREE	28893722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kallmann syndrome	Kallmann Syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of cervix	Cervical Tumor	BEFREE	29572178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31287219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	38340697	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30867731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	24706764		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
FEZF1	8	["Hypogonadotropic hypogonadism","Hypopituitarism","Growth hormone deficiency","Kallmann syndrome","Panhypopituitarism","Pituitary dwarfism","Pituitary short stature","Sheehan syndrome"]	[]	11	["Disgenet (Hypogonadotropic hypogonadism)","ClinVar (Hypogonadotropic hypogonadism)","HPO (Hypogonadotropic hypogonadism)","Disgenet (Hypopituitarism)","Disgenet (Growth hormone deficiency)","Disgenet (Kallmann syndrome)","Orphanet (Kallmann syndrome)","Disgenet (Panhypopituitarism)","Disgenet (Pituitary dwarfism)","Disgenet (Pituitary short stature)","Disgenet (Sheehan syndrome)"]
FGF17	8	["Hypogonadotropic hypogonadism","Hypopituitarism","Growth hormone deficiency","Kallmann syndrome","Panhypopituitarism","Pituitary dwarfism","Pituitary short stature","Sheehan syndrome"]	[]	11	["Disgenet (Hypogonadotropic hypogonadism)","ClinVar (Hypogonadotropic hypogonadism)","HPO (Hypogonadotropic hypogonadism)","Disgenet (Hypopituitarism)","Disgenet (Growth hormone deficiency)","Disgenet (Kallmann syndrome)","Orphanet (Kallmann syndrome)","Disgenet (Panhypopituitarism)","Disgenet (Pituitary dwarfism)","Disgenet (Pituitary short stature)","Disgenet (Sheehan syndrome)"]
HS6ST1	8	["Hypogonadotropic hypogonadism","Hypopituitarism","Growth hormone deficiency","Kallmann syndrome","Panhypopituitarism","Pituitary dwarfism","Pituitary short stature","Sheehan syndrome"]	[]	10	["Disgenet (Hypogonadotropic hypogonadism)","ClinVar (Hypogonadotropic hypogonadism)","Disgenet (Hypopituitarism)","Disgenet (Growth hormone deficiency)","Disgenet (Kallmann syndrome)","Orphanet (Kallmann syndrome)","Disgenet (Panhypopituitarism)","Disgenet (Pituitary dwarfism)","Disgenet (Pituitary short stature)","Disgenet (Sheehan syndrome)"]
NHLH2	8	["Hypogonadotropic hypogonadism","Hypopituitarism","Growth hormone deficiency","Kallmann syndrome","Panhypopituitarism","Pituitary dwarfism","Pituitary short stature","Sheehan syndrome"]	[]	10	["Disgenet (Hypogonadotropic hypogonadism)","ClinVar (Hypogonadotropic hypogonadism)","HPO (Hypogonadotropic hypogonadism)","Disgenet (Hypopituitarism)","Disgenet (Growth hormone deficiency)","Disgenet (Kallmann syndrome)","Disgenet (Panhypopituitarism)","Disgenet (Pituitary dwarfism)","Disgenet (Pituitary short stature)","Disgenet (Sheehan syndrome)"]
SRA1	8	["Hypogonadotropic hypogonadism","Hypopituitarism","Growth hormone deficiency","Kallmann syndrome","Panhypopituitarism","Pituitary dwarfism","Pituitary short stature","Sheehan syndrome"]	[]	10	["Disgenet (Hypogonadotropic hypogonadism)","ClinVar (Hypogonadotropic hypogonadism)","HPO (Hypogonadotropic hypogonadism)","Disgenet (Hypopituitarism)","Disgenet (Growth hormone deficiency)","Disgenet (Kallmann syndrome)","Disgenet (Panhypopituitarism)","Disgenet (Pituitary dwarfism)","Disgenet (Pituitary short stature)","Disgenet (Sheehan syndrome)"]

NDNF (neuron derived neurotrophic factor)

Save This Analysis