ND4 (mitochondrially encoded NADH dehydrogenase 4)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 4538
• Gene name: Mitochondrially encoded NADH dehydrogenase 4
• Gene symbol: ND4
• Synonyms (NCBI Gene): MTND4
• Chromosome: MT
• Chromosome location: -

miRNA Show/Hide all (20)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051935	hsa-let-7b-5p	CLASH	23622248
MIRT051935	hsa-let-7b-5p	CLASH	23622248
MIRT051935	hsa-let-7b-5p	CLASH	23622248
MIRT051789	hsa-let-7c-5p	CLASH	23622248
MIRT051479	hsa-let-7e-5p	CLASH	23622248
MIRT051369	hsa-let-7f-5p	CLASH	23622248
MIRT051369	hsa-let-7f-5p	CLASH	23622248
MIRT050806	hsa-miR-17-5p	CLASH	23622248
MIRT050806	hsa-miR-17-5p	CLASH	23622248
MIRT048266	hsa-miR-196a-5p	CLASH	23622248
MIRT044452	hsa-miR-320a	CLASH	23622248
MIRT044452	hsa-miR-320a	CLASH	23622248
MIRT039502	hsa-miR-652-3p	CLASH	23622248
MIRT039502	hsa-miR-652-3p	CLASH	23622248
MIRT039502	hsa-miR-652-3p	CLASH	23622248
MIRT039502	hsa-miR-652-3p	CLASH	23622248
MIRT038401	hsa-miR-296-3p	CLASH	23622248
MIRT038401	hsa-miR-296-3p	CLASH	23622248
MIRT037806	hsa-miR-455-3p	CLASH	23622248
MIRT048266	hsa-miR-196a-5p	RNA-seq, qRT-PCR	33090325

Gene ontology (GO) Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0003954	Function	NADH dehydrogenase activity	IBA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	28844695
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	IMP	8344246, 8644732, 15250827
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	NAS	3921850
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	IEA
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	IMP	8344246, 8644732, 15250827
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	NAS	3921850
GO:0009060	Process	Aerobic respiration	IBA
GO:0009060	Process	Aerobic respiration	NAS	30030361
GO:0015990	Process	Electron transport coupled proton transport	IBA
GO:0016020	Component	Membrane	IEA
GO:0021549	Process	Cerebellum development	IEA
GO:0032981	Process	Mitochondrial respiratory chain complex I assembly	IMP	8344246, 15250827
GO:0035094	Process	Response to nicotine	IEA
GO:0042773	Process	ATP synthesis coupled electron transport	IEA
GO:0042776	Process	Proton motive force-driven mitochondrial ATP synthesis	NAS	30030361
GO:0045271	Component	Respiratory chain complex I	IBA
GO:0045271	Component	Respiratory chain complex I	IDA	12611891
GO:0045271	Component	Respiratory chain complex I	IEA
GO:0045271	Component	Respiratory chain complex I	NAS	3921850
GO:0045471	Process	Response to ethanol	IEA
GO:0048039	Function	Ubiquinone binding	IBA

Other IDs

• MIM: 516003
• HGNC: 7459
• e!Ensembl: HGNC

Protein

• UniProt ID: P03905
• Protein name: NADH-ubiquinone oxidoreductase chain 4 (EC 7.1.1.2) (NADH dehydrogenase subunit 4)
• Protein function: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor (PubMed:15250827, PubMed:8344246, Pub
• PDB: 5XTC , 5XTD , 5XTH , 5XTI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00361	Proton_antipo_M	112 → 403	Proton-conducting membrane transporter	Family
  PF01059	Oxidored_q5_N	1 → 109	NADH-ubiquinone oxidoreductase chain 4, amino terminus	Family

• Sequence:

  MLKLIVPTIMLLPLTWLSKKHMIWINTTTHSLIISIIPLLFFNQINNNLFSCSPTFSSDP
  LTTPLLMLTTWLLPLTIMASQRHLSSEPLSRKKLYLSMLISLQISLIMTFTATELIMFYI
  FFETTLIPTLAIITRWGNQPERLNAGTYFLFYTLVGSLPLLIALIYTHNTLGSLNILLLT
  LTAQELSNSWANNLMWLAYTMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGG
  YGMMRLTLILNPLTKHMAYPFLVLSLWGMIMTSSICLRQTDLKSLIAYSSISHMALVVTA
  ILIQTPWSFTGAVILMIAHGLTSSLLFCLANSNYERTHSRIMILSQGLQTLLPLMAFWWL
  LASLANLALPPTINLLGELSVLVTTFSWSNITLLLTGLNMLVTALYSLYMFTTTQWGSLT
  HHINNMKPSFTRENTLMFMHLSPILLLSLNPDIITGFSS

• Sequence length: 459

ND4 (-)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Other IDs Associated diseases Related genes Diseases linked via similar genes

Gene

Entrez ID	6775072
Gene name	-
Gene symbol	ND4
Synonyms (NCBI Gene)	-
Chromosome	MT
Chromosome location	-

Other IDs

MIM	HGNC	e!Ensembl
N/A	N/A	N/A

Interactions View interactions

ND4 (-)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Other IDs Associated diseases Related genes Diseases linked via similar genes

Gene

Entrez ID	8923197
Gene name	-
Gene symbol	ND4
Synonyms (NCBI Gene)	-
Chromosome	MT
Chromosome location	-

Other IDs

MIM	HGNC	e!Ensembl
N/A	N/A	N/A

Interactions View interactions

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (25)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
CEREBELLAR ATAXIA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT PALATE AND BILATERAL CLEFT LIP	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL CARDIOMYOPATHY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL DELAY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEARING IMPAIRMENT	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEBER OPTIC ATROPHY AND DYSTONIA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEBER PLUS DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MACULAR DEGENERATION	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELAS SYNDROME	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL COMPLEX I DEFICIENCY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL COMPLEX V DEFICIENCY, MITOCHONDRIAL TYPE 1	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL DISEASES	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROPATHY, ATAXIA, AND RETINITIS PIGMENTOSA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPTIC ATROPHY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPTIC ATROPHY, HEREDITARY, LEBER	—	CTD, Disgenet CTD, Disgenet	15342361, 24569607	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPTIC NEURITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPTIC NEUROPATHY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ROD-CONE DYSTROPHY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	14623372	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULNAR POLYDACTYLY OF FINGERS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (146)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Addison Disease	Addison`s Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	30040709	Associate	★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anterior hypopituitarism	Hypopituitarism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arthrogryposis	Arthrogryposis multiplex congenita	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	31776719	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	24002085, 33731054	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	30949164	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30086823		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	23355257		★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Blindness	Blindness	Pubtator	26606867	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30227369		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35082309	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	12560876		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	33303703	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cerebral cortical atrophy	Cerebral cortical atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	40489465	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	27716073	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	35328073	Associate	★☆☆☆☆ Found in Text Mining only
Creutzfeldt-Jakob Disease, Sporadic	Creutzfeldt-Jakob disease	BEFREE	24667788		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	17382898		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	17382898		★☆☆☆☆ Found in Text Mining only
Deafness	Deafness	Pubtator	17723226	Associate	★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Developmental regression	Developmental regression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37371486	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	Pubtator	31776719	Associate	★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dystonia	Dystonia	Pubtator	31776719	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28990096		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	16620376	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28990096		★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	37569433	Inhibit	★☆☆☆☆ Found in Text Mining only
Gastroparesis	Gastroparesis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Generalized myoclonic seizures	Myoclonic Seizures	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	HPO_DG			★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	18236634		★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	17723226	Associate	★☆☆☆☆ Found in Text Mining only
Heart Block	Heart Block	HPO_DG			★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	30949164	Associate	★☆☆☆☆ Found in Text Mining only
Hemianopsia	Hemianopsia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	38447791	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoparathyroidism	Hypoparathyroidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ichthyoses	Ichthyosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	HPO_DG			★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	33895935	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	29340697		★☆☆☆☆ Found in Text Mining only
Intestinal Obstruction	Intestinal Obstruction	HPO_DG			★☆☆☆☆ Found in Text Mining only
Leber Congenital Amaurosis	Leber Congenital Amaurosis	BEFREE	8449667		★☆☆☆☆ Found in Text Mining only
LEBER OPTIC ATROPHY AND DYSTONIA	Leber Plus Disease	UNIPROT_DG	8644732		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leber plus disease	Leber Plus Disease	ORPHANET_DG	8644732		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leigh Disease	Leigh Syndrome	CLINVAR_DG	15576045, 16120329		★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh Syndrome	BEFREE	17022785, 20502985, 21414825, 24062162, 27761019		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	21826063		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	29679261		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	25592585	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	BEFREE	23355257		★☆☆☆☆ Found in Text Mining only
Malabsorption Syndrome	Malabsorption Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development, Group II	Malformation of cortical development	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	18236634		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30227369		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28990096		★☆☆☆☆ Found in Text Mining only
Maternally Inherited Leigh Syndrome	Maternally Inherited Leigh Syndrome	ORPHANET_DG	20502985		★☆☆☆☆ Found in Text Mining only
MELAS Syndrome	MELAS Syndrome	UNIPROT_DG	1323207		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELAS Syndrome	Melas syndrome	Pubtator	30949164	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELAS Syndrome	MELAS Syndrome	ORPHANET_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Microcephaly	Microcephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mitochondrial complex I deficiency	Mitochondrial complex deficiency	Pubtator	33879611, 8644732, 9685604	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL COMPLEX I DEFICIENCY	Mitochondrial Complex Deficiency	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial Diseases	Mitochondrial disease	Pubtator	17518546, 29587845, 37371486	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial Diseases	Mitochondrial Diseases	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial Myopathies	Mitochondrial myopathy	BEFREE	8384916		★☆☆☆☆ Found in Text Mining only
Mitochondrial Myopathies	Mitochondrial myopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	27055661	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	35154107	Associate	★☆☆☆☆ Found in Text Mining only
Multiple lipomata	Multiple Lipomata	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	35134187	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	30040709	Associate	★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	27770741		★☆☆☆☆ Found in Text Mining only
Nyctalopia	Nyctalopia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Optic Atrophies, Hereditary	Hereditary optic atrophy	CTD_human_DG	11695835, 8662757		★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	BEFREE	22773905		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Optic Atrophy	Optic Atrophy	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Optic Atrophy Hereditary Leber	Leber hereditary optic neuropathy	Pubtator	10933019, 16137960, 17300996, 17320357, 17366829, 17518546, 18513491, 19167085, 1959619, 20454697, 20627642, 20837795, 22879922, 22893673, 23170061, 23805034, 26606867, 26892229, 27426279, 28392196, 30730541, 31234430, 31718067, 31776719, 31888524, 31939618, 32771908, 33451738, 33566264, 33720041, 33911213, 34310464, 34415265, 35035206, 35623556, 35820885, 36074687, 36350566, 36827238, 37071596, 7926004, 8344246, 8593537, 8644732, 9055542, 9685604	Associate	★☆☆☆☆ Found in Text Mining only
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	BEFREE	11117434, 12271374, 16044424, 1635296, 17300996, 17320357, 18771762, 2121024, 21414825, 2286378, 22879922, 23805034, 24525545, 25909222, 26218905, 26892229, 27426279, 29366807, 29444077, 30968497, 31379041, 8099825, 8103501, 8338207, 8448903, 8449667, 9685604		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	CLINVAR_DG	12707444, 16120329, 1937476, 1959619		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	CTD_human_DG	15342361, 24569607		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	UNIPROT_DG	1959619, 1959931, 3201231, 9452107		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Optic Neuropathy	Optic Neuropathy	BEFREE	2121024		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24148579	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	31824475	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral demyelinating neuropathy	Demyelinating neuropathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	HPO_DG			★☆☆☆☆ Found in Text Mining only
Polyneuropathy	Polyneuropathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Preexcitation Syndrome	Wolff-Parkinson-White Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	27770741		★☆☆☆☆ Found in Text Mining only
Psychotic episodes	Psychosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retinal telangiectasia	Retinal telangiectasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	HPO_DG			★☆☆☆☆ Found in Text Mining only
Rod-Cone Dystrophy	Rod-cone dystrophy	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	14623372		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sensorimotor neuropathy	Sensorimotor neuropathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Spontaneous hematomas	Hematomas	HPO_DG			★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37482618	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	33035689, 35464760, 37047426	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	27716073		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	30730541		★☆☆☆☆ Found in Text Mining only
Ventricular preexcitation	Ventricular preexcitation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	17300996, 17723226, 19167085, 20837795, 23805034, 33451738, 33911213, 35035206	Associate	★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	33451738	Inhibit	★☆☆☆☆ Found in Text Mining only
VLCAD deficiency	Very long-chain acyl-coa dehydrogenase deficiency	Pubtator	29736106	Associate	★☆☆☆☆ Found in Text Mining only
West Syndrome	West Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Wolff-Parkinson-White Syndrome	Wolff-Parkinson-White Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

ND5 11 shared diseasesCerebellar ataxia, Cleft palate and bilateral cleft lip, Congenital cardiomyopathy, Developmental delay, Leber hereditary optic neuropathy, Melas syndrome, Mitochondrial complex deficiency, Mitochondrial disease, Neuropathy, ataxia, and retinitis pigmentosa, Postaxial polydactyly, Rod-cone dystrophy 9 shared pathwaysOxidative phosphorylation, Thermogenesis, Retrograde endocannabinoid signaling, Parkinson disease, Prion disease, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy, Respiratory electron transport, Complex I biogenesis 14 shared evidence sourcesDisgenet (Cerebellar ataxia), Disgenet (Parkinson disease), Disgenet (Cleft palate and bilateral cleft lip), Disgenet (Congenital cardiomyopathy), Disgenet (Developmental delay), Disgenet (Hearing loss), CTD (Leber hereditary optic neuropathy), Disgenet (Leber hereditary optic neuropathy), Disgenet (Melas syndrome), Disgenet (Mitochondrial complex deficiency), Disgenet (Mitochondrial disease), Disgenet (Neuropathy, ataxia, and retinitis pigmentosa) +2 more Related via 11 shared diseases including Cerebellar ataxia, Cleft palate and bilateral cleft lip — evidence mostly Disgenet. ND2 11 shared diseasesCerebellar ataxia, Cleft palate and bilateral cleft lip, Developmental delay, Epilepsy, Leber hereditary optic neuropathy, Melas syndrome, Mitochondrial complex deficiency, Mitochondrial disease, Neuropathy, ataxia, and retinitis pigmentosa, Postaxial polydactyly, Rod-cone dystrophy 9 shared pathwaysOxidative phosphorylation, Thermogenesis, Retrograde endocannabinoid signaling, Parkinson disease, Prion disease, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy, Respiratory electron transport, Complex I biogenesis 13 shared evidence sourcesDisgenet (Cerebellar ataxia), Disgenet (Parkinson disease), Disgenet (Cleft palate and bilateral cleft lip), Disgenet (Developmental delay), Disgenet (Epilepsy), CTD (Leber hereditary optic neuropathy), Disgenet (Leber hereditary optic neuropathy), Disgenet (Melas syndrome), Disgenet (Mitochondrial complex deficiency), Disgenet (Mitochondrial disease), Disgenet (Neuropathy, ataxia, and retinitis pigmentosa), Disgenet (Postaxial polydactyly) +1 more Related via 11 shared diseases including Cerebellar ataxia, Cleft palate and bilateral cleft lip — evidence mostly Disgenet. ND3 9 shared diseasesCerebellar ataxia, Cleft palate and bilateral cleft lip, Leber hereditary optic neuropathy, Melas syndrome, Mitochondrial complex deficiency, Mitochondrial disease, Neuropathy, ataxia, and retinitis pigmentosa, Postaxial polydactyly, Rod-cone dystrophy 9 shared pathwaysOxidative phosphorylation, Thermogenesis, Retrograde endocannabinoid signaling, Parkinson disease, Prion disease, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy, Respiratory electron transport, Complex I biogenesis 10 shared evidence sourcesDisgenet (Cerebellar ataxia), Disgenet (Parkinson disease), Disgenet (Cleft palate and bilateral cleft lip), Disgenet (Leber hereditary optic neuropathy), Disgenet (Melas syndrome), Disgenet (Mitochondrial complex deficiency), Disgenet (Mitochondrial disease), Disgenet (Neuropathy, ataxia, and retinitis pigmentosa), Disgenet (Postaxial polydactyly), Disgenet (Rod-cone dystrophy) Related via 9 shared diseases including Cerebellar ataxia, Cleft palate and bilateral cleft lip — evidence mostly Disgenet. ND1 12 shared diseasesCerebellar ataxia, Optic atrophy, Cleft palate and bilateral cleft lip, Leber hereditary optic neuropathy, Melas syndrome, Mitochondrial complex deficiency, Mitochondrial disease, Neuropathy, ataxia, and retinitis pigmentosa, Optic neuropathy, Peripheral neuropathy, Postaxial polydactyly, Rod-cone dystrophy 9 shared pathwaysOxidative phosphorylation, Thermogenesis, Retrograde endocannabinoid signaling, Parkinson disease, Prion disease, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy, Respiratory electron transport, Complex I biogenesis 14 shared evidence sourcesDisgenet (Cerebellar ataxia), Disgenet (Parkinson disease), Disgenet (Optic atrophy), Disgenet (Cleft palate and bilateral cleft lip), CTD (Leber hereditary optic neuropathy), Disgenet (Leber hereditary optic neuropathy), Disgenet (Melas syndrome), Disgenet (Mitochondrial complex deficiency), Disgenet (Mitochondrial disease), Disgenet (Neuropathy, ataxia, and retinitis pigmentosa), Disgenet (Optic neuropathy), Disgenet (Peripheral neuropathy) +2 more Related via 12 shared diseases including Cerebellar ataxia, Optic atrophy — evidence mostly Disgenet. ND4L 8 shared diseasesCerebellar ataxia, Cleft palate and bilateral cleft lip, Leber hereditary optic neuropathy, Mitochondrial complex deficiency, Mitochondrial disease, Neuropathy, ataxia, and retinitis pigmentosa, Postaxial polydactyly, Rod-cone dystrophy 7 shared pathwaysOxidative phosphorylation, Thermogenesis, Retrograde endocannabinoid signaling, Parkinson disease, Prion disease, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy 9 shared evidence sourcesDisgenet (Cerebellar ataxia), Disgenet (Cleft palate and bilateral cleft lip), CTD (Leber hereditary optic neuropathy), Disgenet (Leber hereditary optic neuropathy), Disgenet (Mitochondrial complex deficiency), Disgenet (Mitochondrial disease), Disgenet (Neuropathy, ataxia, and retinitis pigmentosa), Disgenet (Postaxial polydactyly), Disgenet (Rod-cone dystrophy) Related via 8 shared diseases including Cerebellar ataxia, Cleft palate and bilateral cleft lip — evidence mostly Disgenet.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
ND5	11	["Cerebellar ataxia","Cleft palate and bilateral cleft lip","Congenital cardiomyopathy","Developmental delay","Leber hereditary optic neuropathy","Melas syndrome","Mitochondrial complex deficiency","Mitochondrial disease","Neuropathy, ataxia, and retinitis pigmentosa","Postaxial polydactyly","Rod-cone dystrophy"]	9	["Oxidative phosphorylation","Thermogenesis","Retrograde endocannabinoid signaling","Parkinson disease","Prion disease","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy","Respiratory electron transport","Complex I biogenesis"]	14	["Disgenet (Cerebellar ataxia)","Disgenet (Parkinson disease)","Disgenet (Cleft palate and bilateral cleft lip)","Disgenet (Congenital cardiomyopathy)","Disgenet (Developmental delay)","Disgenet (Hearing loss)","CTD (Leber hereditary optic neuropathy)","Disgenet (Leber hereditary optic neuropathy)","Disgenet (Melas syndrome)","Disgenet (Mitochondrial complex deficiency)","Disgenet (Mitochondrial disease)","Disgenet (Neuropathy, ataxia, and retinitis pigmentosa)"]
ND2	11	["Cerebellar ataxia","Cleft palate and bilateral cleft lip","Developmental delay","Epilepsy","Leber hereditary optic neuropathy","Melas syndrome","Mitochondrial complex deficiency","Mitochondrial disease","Neuropathy, ataxia, and retinitis pigmentosa","Postaxial polydactyly","Rod-cone dystrophy"]	9	["Oxidative phosphorylation","Thermogenesis","Retrograde endocannabinoid signaling","Parkinson disease","Prion disease","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy","Respiratory electron transport","Complex I biogenesis"]	13	["Disgenet (Cerebellar ataxia)","Disgenet (Parkinson disease)","Disgenet (Cleft palate and bilateral cleft lip)","Disgenet (Developmental delay)","Disgenet (Epilepsy)","CTD (Leber hereditary optic neuropathy)","Disgenet (Leber hereditary optic neuropathy)","Disgenet (Melas syndrome)","Disgenet (Mitochondrial complex deficiency)","Disgenet (Mitochondrial disease)","Disgenet (Neuropathy, ataxia, and retinitis pigmentosa)","Disgenet (Postaxial polydactyly)"]
ND3	9	["Cerebellar ataxia","Cleft palate and bilateral cleft lip","Leber hereditary optic neuropathy","Melas syndrome","Mitochondrial complex deficiency","Mitochondrial disease","Neuropathy, ataxia, and retinitis pigmentosa","Postaxial polydactyly","Rod-cone dystrophy"]	9	["Oxidative phosphorylation","Thermogenesis","Retrograde endocannabinoid signaling","Parkinson disease","Prion disease","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy","Respiratory electron transport","Complex I biogenesis"]	10	["Disgenet (Cerebellar ataxia)","Disgenet (Parkinson disease)","Disgenet (Cleft palate and bilateral cleft lip)","Disgenet (Leber hereditary optic neuropathy)","Disgenet (Melas syndrome)","Disgenet (Mitochondrial complex deficiency)","Disgenet (Mitochondrial disease)","Disgenet (Neuropathy, ataxia, and retinitis pigmentosa)","Disgenet (Postaxial polydactyly)","Disgenet (Rod-cone dystrophy)"]
ND1	12	["Cerebellar ataxia","Optic atrophy","Cleft palate and bilateral cleft lip","Leber hereditary optic neuropathy","Melas syndrome","Mitochondrial complex deficiency","Mitochondrial disease","Neuropathy, ataxia, and retinitis pigmentosa","Optic neuropathy","Peripheral neuropathy","Postaxial polydactyly","Rod-cone dystrophy"]	9	["Oxidative phosphorylation","Thermogenesis","Retrograde endocannabinoid signaling","Parkinson disease","Prion disease","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy","Respiratory electron transport","Complex I biogenesis"]	14	["Disgenet (Cerebellar ataxia)","Disgenet (Parkinson disease)","Disgenet (Optic atrophy)","Disgenet (Cleft palate and bilateral cleft lip)","CTD (Leber hereditary optic neuropathy)","Disgenet (Leber hereditary optic neuropathy)","Disgenet (Melas syndrome)","Disgenet (Mitochondrial complex deficiency)","Disgenet (Mitochondrial disease)","Disgenet (Neuropathy, ataxia, and retinitis pigmentosa)","Disgenet (Optic neuropathy)","Disgenet (Peripheral neuropathy)"]
ND4L	8	["Cerebellar ataxia","Cleft palate and bilateral cleft lip","Leber hereditary optic neuropathy","Mitochondrial complex deficiency","Mitochondrial disease","Neuropathy, ataxia, and retinitis pigmentosa","Postaxial polydactyly","Rod-cone dystrophy"]	7	["Oxidative phosphorylation","Thermogenesis","Retrograde endocannabinoid signaling","Parkinson disease","Prion disease","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy"]	9	["Disgenet (Cerebellar ataxia)","Disgenet (Cleft palate and bilateral cleft lip)","CTD (Leber hereditary optic neuropathy)","Disgenet (Leber hereditary optic neuropathy)","Disgenet (Mitochondrial complex deficiency)","Disgenet (Mitochondrial disease)","Disgenet (Neuropathy, ataxia, and retinitis pigmentosa)","Disgenet (Postaxial polydactyly)","Disgenet (Rod-cone dystrophy)"]

Diseases Linked via Similar Genes

Leigh syndrome Linked via 3 of 5 related genesND5, ND2, ND3 Alzheimer disease Linked via 2 of 5 related genesND2, ND1 Hepatocellular carcinoma Linked via 1 of 5 related genesND5 Myoclonic epilepsy with ragged red fibers Linked via 1 of 5 related genesND5 Multiple sclerosis Linked via 1 of 5 related genesND2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Leigh syndrome	3	["ND5","ND2","ND3"]
Alzheimer disease	2	["ND2","ND1"]
Hepatocellular carcinoma	1	["ND5"]
Myoclonic epilepsy with ragged red fibers	1	["ND5"]
Multiple sclerosis	1	["ND2"]