Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	9
Gene name	N-acetyltransferase 1
Gene symbol	NAT1
Synonyms (NCBI Gene)	AAC1MNATNAT-1NATI
Chromosome	8
Chromosome location	8p22
Summary	This gene is one of two arylamine N-acetyltransferase (NAT) genes in the human genome, and is orthologous to the mouse and rat Nat2 genes. The enzyme encoded by this gene catalyzes the transfer of an acetyl group from acetyl-CoA to various arylamine and h

27 Show/Hide all (27)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030309	hsa-miR-26b-5p	Microarray	19088304
MIRT050208	hsa-miR-25-3p	CLASH	23622248
MIRT1174316	hsa-miR-1264	CLIP-seq
MIRT1174317	hsa-miR-3613-3p	CLIP-seq
MIRT1174318	hsa-miR-548aa	CLIP-seq
MIRT1174319	hsa-miR-548ac	CLIP-seq
MIRT1174320	hsa-miR-548d-3p	CLIP-seq
MIRT1174321	hsa-miR-548z	CLIP-seq
MIRT1174322	hsa-miR-1305	CLIP-seq
MIRT1174317	hsa-miR-3613-3p	CLIP-seq
MIRT1174323	hsa-miR-3671	CLIP-seq
MIRT1174318	hsa-miR-548aa	CLIP-seq
MIRT1174319	hsa-miR-548ac	CLIP-seq
MIRT1174320	hsa-miR-548d-3p	CLIP-seq
MIRT1174321	hsa-miR-548z	CLIP-seq
MIRT1174324	hsa-miR-607	CLIP-seq
MIRT2050434	hsa-miR-582-3p	CLIP-seq
MIRT2279521	hsa-miR-1290	CLIP-seq
MIRT2279522	hsa-miR-2964a-5p	CLIP-seq
MIRT2279523	hsa-miR-3159	CLIP-seq
MIRT2279524	hsa-miR-4659a-3p	CLIP-seq
MIRT2279525	hsa-miR-4659b-3p	CLIP-seq
MIRT2279526	hsa-miR-4698	CLIP-seq
MIRT2391356	hsa-miR-151-5p	CLIP-seq
MIRT2391357	hsa-miR-151b	CLIP-seq
MIRT2391358	hsa-miR-3131	CLIP-seq
MIRT2391359	hsa-miR-611	CLIP-seq

Transcription factor	Regulation	Reference
AR	Activation	17210686
HSF1	Activation	20176657

10 Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004060	Function	Arylamine N-acetyltransferase activity	IBA
GO:0004060	Function	Arylamine N-acetyltransferase activity	IEA
GO:0004060	Function	Arylamine N-acetyltransferase activity	TAS	10908296
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0016407	Function	Acetyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA

MIM	HGNC	e!Ensembl
108345	7645	ENSG00000171428

P18440

Protein name

Arylamine N-acetyltransferase 1 (EC 2.3.1.5) (Arylamide acetylase 1) (Monomorphic arylamine N-acetyltransferase) (MNAT) (N-acetyltransferase type 1) (NAT-1)

Protein function

Participates in the detoxification of a plethora of hydrazine and arylamine drugs. Catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several known carcinogens.

PDB

2IJA , 2PQT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00797	Acetyltransf_2	20 → 280	N-acetyltransferase	Family

Sequence

MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVV
RRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYI
VDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDL
LEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLT
HRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI

Sequence length

290

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Caffeine metabolism	Acetylation
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis - DNA adducts

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (9)
ASTHMA	—	CTD, Disgenet CTD, Disgenet	31809667	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, OCCUPATIONAL	—	CTD, Disgenet CTD, Disgenet	19834256	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	34734193	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NAT1*17 ALLELE	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	12618593	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	33667223	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	16003747	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

NAT1 (N-acetyltransferase 1)

Bookmark This Gene