Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	119391
Gene name	Glutathione S-transferase omega 2
Gene symbol	GSTO2
Synonyms (NCBI Gene)	GSTO 2-2bA127L20.1
Chromosome	10
Chromosome location	10q25.1
Summary	The protein encoded by this gene is an omega class glutathione S-transferase (GST). GSTs are involved in the metabolism of xenobiotics and carcinogens. Four transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq,

70 Show/Hide all (70)

miRTarBase ID	miRNA	Experiments	Reference
MIRT681099	hsa-miR-4712-3p	HITS-CLIP	23706177
MIRT681098	hsa-miR-218-2-3p	HITS-CLIP	23706177
MIRT681097	hsa-miR-3158-5p	HITS-CLIP	23706177
MIRT681096	hsa-miR-1184	HITS-CLIP	23706177
MIRT681095	hsa-miR-1205	HITS-CLIP	23706177
MIRT681094	hsa-miR-17-3p	HITS-CLIP	23706177
MIRT681093	hsa-miR-6847-3p	HITS-CLIP	23706177
MIRT681092	hsa-miR-4999-5p	HITS-CLIP	23706177
MIRT681091	hsa-miR-4284	HITS-CLIP	23706177
MIRT681090	hsa-miR-24-3p	HITS-CLIP	23706177
MIRT681089	hsa-miR-182-3p	HITS-CLIP	23706177
MIRT681088	hsa-miR-597-3p	HITS-CLIP	23706177
MIRT681087	hsa-miR-152-5p	HITS-CLIP	23706177
MIRT681086	hsa-miR-6511b-5p	HITS-CLIP	23706177
MIRT681085	hsa-miR-6811-5p	HITS-CLIP	23706177
MIRT681084	hsa-miR-8057	HITS-CLIP	23706177
MIRT681083	hsa-miR-544a	HITS-CLIP	23706177
MIRT657554	hsa-miR-4717-5p	HITS-CLIP	23824327
MIRT657553	hsa-miR-1972	HITS-CLIP	23824327
MIRT657554	hsa-miR-4717-5p	HITS-CLIP	23824327
MIRT657553	hsa-miR-1972	HITS-CLIP	23824327
MIRT657552	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT657551	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT657550	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT657549	hsa-miR-3925-3p	HITS-CLIP	23824327
MIRT657548	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT657547	hsa-miR-4777-3p	HITS-CLIP	23824327
MIRT657546	hsa-miR-1245b-5p	HITS-CLIP	23824327
MIRT657545	hsa-miR-3142	HITS-CLIP	23824327
MIRT657544	hsa-miR-532-5p	HITS-CLIP	23824327
MIRT657543	hsa-miR-203a-3p	HITS-CLIP	23824327
MIRT657542	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT657541	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT657540	hsa-miR-578	HITS-CLIP	23824327
MIRT657539	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT681099	hsa-miR-4712-3p	HITS-CLIP	23706177
MIRT681098	hsa-miR-218-2-3p	HITS-CLIP	23706177
MIRT681097	hsa-miR-3158-5p	HITS-CLIP	23706177
MIRT681096	hsa-miR-1184	HITS-CLIP	23706177
MIRT681095	hsa-miR-1205	HITS-CLIP	23706177
MIRT681094	hsa-miR-17-3p	HITS-CLIP	23706177
MIRT681093	hsa-miR-6847-3p	HITS-CLIP	23706177
MIRT681092	hsa-miR-4999-5p	HITS-CLIP	23706177
MIRT681091	hsa-miR-4284	HITS-CLIP	23706177
MIRT681090	hsa-miR-24-3p	HITS-CLIP	23706177
MIRT681089	hsa-miR-182-3p	HITS-CLIP	23706177
MIRT681088	hsa-miR-597-3p	HITS-CLIP	23706177
MIRT681087	hsa-miR-152-5p	HITS-CLIP	23706177
MIRT681086	hsa-miR-6511b-5p	HITS-CLIP	23706177
MIRT681085	hsa-miR-6811-5p	HITS-CLIP	23706177
MIRT681084	hsa-miR-8057	HITS-CLIP	23706177
MIRT681083	hsa-miR-544a	HITS-CLIP	23706177
MIRT657554	hsa-miR-4717-5p	HITS-CLIP	23824327
MIRT657553	hsa-miR-1972	HITS-CLIP	23824327
MIRT657554	hsa-miR-4717-5p	HITS-CLIP	23824327
MIRT657553	hsa-miR-1972	HITS-CLIP	23824327
MIRT657552	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT657551	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT657550	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT657549	hsa-miR-3925-3p	HITS-CLIP	23824327
MIRT657548	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT657547	hsa-miR-4777-3p	HITS-CLIP	23824327
MIRT657546	hsa-miR-1245b-5p	HITS-CLIP	23824327
MIRT657545	hsa-miR-3142	HITS-CLIP	23824327
MIRT657544	hsa-miR-532-5p	HITS-CLIP	23824327
MIRT657543	hsa-miR-203a-3p	HITS-CLIP	23824327
MIRT657542	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT657541	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT657540	hsa-miR-578	HITS-CLIP	23824327
MIRT657539	hsa-miR-4446-5p	HITS-CLIP	23824327

23 Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004364	Function	Glutathione transferase activity	IBA
GO:0004364	Function	Glutathione transferase activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 25910212, 31515488, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006749	Process	Glutathione metabolic process	IBA
GO:0006805	Process	Xenobiotic metabolic process	IDA	15970797
GO:0016491	Function	Oxidoreductase activity	IDA	15970797
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019852	Process	L-ascorbic acid metabolic process	IBA
GO:0019852	Process	L-ascorbic acid metabolic process	IDA	15970797
GO:0019852	Process	L-ascorbic acid metabolic process	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0045174	Function	Glutathione dehydrogenase (ascorbate) activity	IBA
GO:0045174	Function	Glutathione dehydrogenase (ascorbate) activity	IDA	15970797
GO:0045174	Function	Glutathione dehydrogenase (ascorbate) activity	IEA
GO:0050610	Function	Methylarsonate reductase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0071243	Process	Cellular response to arsenic-containing substance	IDA	15970797
GO:0071243	Process	Cellular response to arsenic-containing substance	IEA
GO:0098869	Process	Cellular oxidant detoxification	IEA

MIM	HGNC	e!Ensembl
612314	23064	ENSG00000065621

Q9H4Y5

Protein name

Glutathione S-transferase omega-2 (GSTO-2) (EC 2.5.1.18) (Glutathione S-transferase omega 2-2) (GSTO 2-2) (Glutathione-dependent dehydroascorbate reductase) (EC 1.8.5.1) (Monomethylarsonic acid reductase) (MMA(V) reductase) (EC 1.20.4.2)

Protein function

Exhibits glutathione-dependent thiol transferase activity. Has high dehydroascorbate reductase activity and may contribute to the recycling of ascorbic acid. Participates in the biotransformation of inorganic arsenic and reduces monomethylarsoni

PDB

3Q18 , 3Q19 , 3QAG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13410	GST_C_2	108 → 206		Domain
PF13417	GST_N_3	26 → 101	Glutathione S-transferase, N-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in a range of tissues, including the liver, kidney, skeletal muscle and prostate. Strongest expression in the testis. {ECO:0000269|PubMed:12618591}.

Sequence

MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKP
EWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELF
CKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWP
WFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDF
GLC

Sequence length

243

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Glutathione metabolism	Glutathione conjugation
Metabolism of xenobiotics by cytochrome P450	Vitamin C (ascorbate) metabolism
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis - DNA adducts
Chemical carcinogenesis - receptor activation
Chemical carcinogenesis - reactive oxygen species
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (7)
ALZHEIMERS DISEASE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	39358599	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	39358599	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	22306368	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	40050615	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (66)
Alzheimer Disease	Alzheimer disease	Pubtator	15040808, 15985314	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	34311603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	20374258, 22040239, 24471578		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	24471578	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	22306368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	22306368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19859803, 20210239, 23376175, 25300926, 26993125, 28670895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25835968, 25892883, 27221910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	22306368, 25716313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	30224590	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	16761626, 19859803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	21605854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	22876127, 23927022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	22876127	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30417762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	19513904, 22044695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	30224590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21113667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	25395496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30224590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	36676788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36676788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	26103006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	27221910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	15040808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	30224590	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30224590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	23079717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25835968, 25892883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22044695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25835968	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19859803, 20210239, 23376175, 25300926, 26993125, 28670895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	16761626, 19859803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	18398695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	22306368, 25716313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	22306368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15992993, 18398695, 21113667, 21798077, 25300926, 25835968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25835968, 31738399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	30224590	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29435097, 30224590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nuclear cataract	Cataract	BEFREE	23927022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nuclear non-senile cataract	Cataract	BEFREE	23927022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30224590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	30224590	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16761626, 19859803		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	16761626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	14570706, 15040808, 15917099, 20472488, 22494505		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	15040808, 15985314	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	17194543	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	25726706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	25726706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	17903307, 22044695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30224590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	17505575	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	29323258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 2	Spinocerebellar Ataxia	BEFREE	28017238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31738399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23086268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	18398695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34925643	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	25716313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Toxic Shock Syndrome	Toxic Shock Syndrome	BEFREE	26993125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	25716313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	22306368, 24040330	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	19686770, 21094982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	29943815		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
GSTM3	0	[]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	2	["Disgenet (Alzheimer disease)","Disgenet (Asthma)"]
GSTO1	0	[]	12	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation","Vitamin C (ascorbate) metabolism"]	2	["Disgenet (Alzheimer disease)","Disgenet (Parkinson disease)"]
GSTT1	0	[]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	3	["Disgenet (Alzheimer disease)","Disgenet (Asthma)","Disgenet (Parkinson disease)"]
GSTM1	1	["Urinary bladder neoplasms"]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	3	["Disgenet (Asthma)","Disgenet (Parkinson disease)","CTD (Urinary bladder neoplasms)"]
GSTA5	0	[]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	0	[]

GSTO2 (glutathione S-transferase omega 2)

Save This Analysis