Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	80179
Gene name	Myosin XIX
Gene symbol	MYO19
Synonyms (NCBI Gene)	MYOHD1
Chromosome	17
Chromosome location	17q12

131 Show/Hide all (131)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023003	hsa-miR-124-3p	Microarray	18668037
MIRT028110	hsa-miR-93-5p	Sequencing	20371350
MIRT051272	hsa-miR-16-5p	CLASH	23622248
MIRT049142	hsa-miR-92a-3p	CLASH	23622248
MIRT045930	hsa-miR-125b-5p	CLASH	23622248
MIRT045295	hsa-miR-186-5p	CLASH	23622248
MIRT041011	hsa-miR-505-3p	CLASH	23622248
MIRT039861	hsa-miR-615-3p	CLASH	23622248
MIRT1169280	hsa-let-7a	CLIP-seq
MIRT1169281	hsa-let-7b	CLIP-seq
MIRT1169282	hsa-let-7c	CLIP-seq
MIRT1169283	hsa-let-7d	CLIP-seq
MIRT1169284	hsa-let-7e	CLIP-seq
MIRT1169285	hsa-let-7f	CLIP-seq
MIRT1169286	hsa-let-7g	CLIP-seq
MIRT1169287	hsa-let-7i	CLIP-seq
MIRT1169288	hsa-miR-3189-3p	CLIP-seq
MIRT1169289	hsa-miR-3689d	CLIP-seq
MIRT1169290	hsa-miR-432	CLIP-seq
MIRT1169291	hsa-miR-4443	CLIP-seq
MIRT1169292	hsa-miR-4458	CLIP-seq
MIRT1169293	hsa-miR-4500	CLIP-seq
MIRT1169294	hsa-miR-502-5p	CLIP-seq
MIRT1169295	hsa-miR-98	CLIP-seq
MIRT1169296	hsa-miR-1206	CLIP-seq
MIRT1169297	hsa-miR-1208	CLIP-seq
MIRT1169298	hsa-miR-3607-5p	CLIP-seq
MIRT2048743	hsa-miR-3136-3p	CLIP-seq
MIRT2048744	hsa-miR-3184	CLIP-seq
MIRT2048745	hsa-miR-423-5p	CLIP-seq
MIRT2277629	hsa-miR-106a	CLIP-seq
MIRT2277630	hsa-miR-106b	CLIP-seq
MIRT2277631	hsa-miR-1254	CLIP-seq
MIRT2277632	hsa-miR-17	CLIP-seq
MIRT2277633	hsa-miR-196a	CLIP-seq
MIRT2277634	hsa-miR-196b	CLIP-seq
MIRT2277635	hsa-miR-199a-5p	CLIP-seq
MIRT2277636	hsa-miR-199b-5p	CLIP-seq
MIRT2277637	hsa-miR-203	CLIP-seq
MIRT2277638	hsa-miR-20a	CLIP-seq
MIRT2277639	hsa-miR-20b	CLIP-seq
MIRT2277640	hsa-miR-2355-5p	CLIP-seq
MIRT2277641	hsa-miR-299-3p	CLIP-seq
MIRT2277642	hsa-miR-302a	CLIP-seq
MIRT2277643	hsa-miR-302b	CLIP-seq
MIRT2277644	hsa-miR-302c	CLIP-seq
MIRT2277645	hsa-miR-302d	CLIP-seq
MIRT2277646	hsa-miR-302e	CLIP-seq
MIRT2277647	hsa-miR-3116	CLIP-seq
MIRT2277648	hsa-miR-3128	CLIP-seq
MIRT2277649	hsa-miR-3171	CLIP-seq
MIRT2277650	hsa-miR-3190	CLIP-seq
MIRT2277651	hsa-miR-3606	CLIP-seq
MIRT2277652	hsa-miR-3611	CLIP-seq
MIRT2277653	hsa-miR-372	CLIP-seq
MIRT2277654	hsa-miR-373	CLIP-seq
MIRT2277655	hsa-miR-3920	CLIP-seq
MIRT2277656	hsa-miR-4280	CLIP-seq
MIRT2277657	hsa-miR-4293	CLIP-seq
MIRT2277658	hsa-miR-4491	CLIP-seq
MIRT2277659	hsa-miR-450b-3p	CLIP-seq
MIRT2277660	hsa-miR-4657	CLIP-seq
MIRT2277661	hsa-miR-4659a-3p	CLIP-seq
MIRT2277662	hsa-miR-4659b-3p	CLIP-seq
MIRT2277663	hsa-miR-4663	CLIP-seq
MIRT2277664	hsa-miR-4677-3p	CLIP-seq
MIRT2277665	hsa-miR-4679	CLIP-seq
MIRT2277666	hsa-miR-4682	CLIP-seq
MIRT2277667	hsa-miR-4687-3p	CLIP-seq
MIRT2277668	hsa-miR-4713-3p	CLIP-seq
MIRT2277669	hsa-miR-4720-5p	CLIP-seq
MIRT2277670	hsa-miR-4799-3p	CLIP-seq
MIRT2277671	hsa-miR-493	CLIP-seq
MIRT2277672	hsa-miR-511	CLIP-seq
MIRT2277673	hsa-miR-519d	CLIP-seq
MIRT2277674	hsa-miR-520a-3p	CLIP-seq
MIRT2277675	hsa-miR-520b	CLIP-seq
MIRT2277676	hsa-miR-520c-3p	CLIP-seq
MIRT2277677	hsa-miR-520d-3p	CLIP-seq
MIRT2277678	hsa-miR-520e	CLIP-seq
MIRT2277679	hsa-miR-520f	CLIP-seq
MIRT2277680	hsa-miR-548t	CLIP-seq
MIRT2277681	hsa-miR-596	CLIP-seq
MIRT2277682	hsa-miR-638	CLIP-seq
MIRT2277683	hsa-miR-647	CLIP-seq
MIRT2277684	hsa-miR-769-3p	CLIP-seq
MIRT2277685	hsa-miR-885-3p	CLIP-seq
MIRT2277686	hsa-miR-93	CLIP-seq
MIRT1169296	hsa-miR-1206	CLIP-seq
MIRT1169297	hsa-miR-1208	CLIP-seq
MIRT2277631	hsa-miR-1254	CLIP-seq
MIRT2576393	hsa-miR-1273e	CLIP-seq
MIRT2576394	hsa-miR-1285	CLIP-seq
MIRT2576395	hsa-miR-1291	CLIP-seq
MIRT2576396	hsa-miR-148a	CLIP-seq
MIRT2576397	hsa-miR-148b	CLIP-seq
MIRT2576398	hsa-miR-152	CLIP-seq
MIRT2277633	hsa-miR-196a	CLIP-seq
MIRT2277634	hsa-miR-196b	CLIP-seq
MIRT2277637	hsa-miR-203	CLIP-seq
MIRT2277647	hsa-miR-3116	CLIP-seq
MIRT2576399	hsa-miR-3135b	CLIP-seq
MIRT2277649	hsa-miR-3171	CLIP-seq
MIRT2576400	hsa-miR-3187-5p	CLIP-seq
MIRT2576401	hsa-miR-326	CLIP-seq
MIRT2576402	hsa-miR-328	CLIP-seq
MIRT2576403	hsa-miR-330-5p	CLIP-seq
MIRT2277651	hsa-miR-3606	CLIP-seq
MIRT1169298	hsa-miR-3607-5p	CLIP-seq
MIRT2277652	hsa-miR-3611	CLIP-seq
MIRT2576404	hsa-miR-3652	CLIP-seq
MIRT2576405	hsa-miR-4283	CLIP-seq
MIRT2277657	hsa-miR-4293	CLIP-seq
MIRT2576406	hsa-miR-4430	CLIP-seq
MIRT2576407	hsa-miR-4508	CLIP-seq
MIRT2277663	hsa-miR-4663	CLIP-seq
MIRT2277664	hsa-miR-4677-3p	CLIP-seq
MIRT2277665	hsa-miR-4679	CLIP-seq
MIRT2277666	hsa-miR-4682	CLIP-seq
MIRT2277671	hsa-miR-493	CLIP-seq
MIRT2277679	hsa-miR-520f	CLIP-seq
MIRT2576408	hsa-miR-521	CLIP-seq
MIRT2576409	hsa-miR-564	CLIP-seq
MIRT2277681	hsa-miR-596	CLIP-seq
MIRT2576410	hsa-miR-612	CLIP-seq
MIRT2576411	hsa-miR-636	CLIP-seq
MIRT2576412	hsa-miR-663b	CLIP-seq
MIRT2576413	hsa-miR-760	CLIP-seq
MIRT2685679	hsa-miR-33a	CLIP-seq
MIRT2685680	hsa-miR-33b	CLIP-seq
MIRT2685681	hsa-miR-664	CLIP-seq

33 Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000146	Function	Microfilament motor activity	IBA
GO:0000166	Function	Nucleotide binding	IEA
GO:0003774	Function	Cytoskeletal motor activity	IEA
GO:0003779	Function	Actin binding	IDA	23568824
GO:0003779	Function	Actin binding	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	23568824, 25447992
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IDA	27126804
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006897	Process	Endocytosis	IBA
GO:0007015	Process	Actin filament organization	IBA
GO:0008092	Function	Cytoskeletal protein binding	IEA
GO:0015629	Component	Actin cytoskeleton	IBA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016459	Component	Myosin complex	IEA
GO:0016887	Function	ATP hydrolysis activity	IDA	23568824
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0032027	Function	Myosin light chain binding	IEA
GO:0032465	Process	Regulation of cytokinesis	IMP	25447992
GO:0034642	Process	Mitochondrion migration along actin filament	IDA	19932026
GO:0051015	Function	Actin filament binding	IBA
GO:0051654	Process	Establishment of mitochondrion localization	IEA
GO:0060002	Function	Plus-end directed microfilament motor activity	IEA
GO:0090140	Process	Regulation of mitochondrial fission	IMP	25447992
GO:0160040	Process	Mitocytosis	IEA

MIM	HGNC	e!Ensembl
617379	26234	ENSG00000278259

Q96H55

Protein name

Unconventional myosin-XIX (Myosin head domain-containing protein 1)

Protein function

Actin-based motor molecule with ATPase activity that localizes to the mitochondrion outer membrane (PubMed:19932026, PubMed:23568824, PubMed:25447992). Motor protein that moves towards the plus-end of actin filaments (By similarity). Required fo

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00063	Myosin_head	37 → 684	Myosin head (motor domain)	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed in multiple tissues and cell lines. {ECO:0000269|PubMed:19932026}.

Sequence

MLQQVNGHNPGSDGQAREYLREDLQEFLGGEVLLYKLDDLTRVNPVTLETVLRCLQARYM
ADTFYTNAGCTLVALNPFKPVPQLYSPELMREYHAAPQPQKLKPHVFTVGEQTYRNVKSL
IEPVNQSIVVSGESGAGKTWTSRCLMKFYAVVATSPASWESHKIAERIEQRILNSNPVME
AFGNACTLRNNNSSRFGKFIQLQLNRAQQMTGAAVQTYLLEKTRVACQASSERNFHIFYQ
ICKGASEDERLQWHLPEGAAFSWLPNPERSLEEDCFEVTREAMLHLGIDTPTQNNIFKVL
AGLLHLGNIQFAASEDEAQPCQPMDDAKYSVRTAASLLGLPEDVLLEMVQIRTIRAGRQQ
QVFRKPCARAECDTRRDCLAKLIYARLFDWLVSVINSSICADTDSWTTFIGLLDVYGFES
FPDNSLEQLCINYANEKLQQHFVAHYLRAQQEEYAVEGLEWSFINYQDNQPCLDLIEGSP
ISICSLINEECRLNRPSSAAQLQTRIETALAGSPCLGHNKLSREPSFIVVHYAGPVRYHT
AGLVEKNKDPIPPELTRLLQQSQDPLLMGLFPTNPKEKTQEEPPGQSRAPVLTVVSKFKA
SLEQLLQVLHSTTPHYIRCIKPNSQGQAQTFLQEEVLSQLEACGLVETIHISAAGFPIRV
SHRNFVERYKLLRRLHPCTSSGPDSPYPAKGLPEWCPHSEEATLEPLIQDILHTLPVLTQ
AAAITGDSAEAMPAPMHCGRTKVFMTDSMLELLECGRARVLEQCARCIQGGWRRHRHREQ
ERQWRAVMLIQAAIRSWLTRKHIQRLHAAATVIKRAWQKWRIRMACLAAKELDGVEEKHF
SQAPCSLSTSPLQTRLLEAIIRLWPLGLVLANTAMGVGSFQRKLVVWACLQLPRGSPSSY
TVQTAQDQAGVTSIRALPQGSIKFHCRKSPLRYADICPEPSPYSITGFNQILLERHRLIH
VTSSAFTGLG

Sequence length

970

Interactions

View interactions

KEGG Pathway
Motor proteins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (13)
ANOREXIA NERVOSA	—	GWAS catalog	36137488, 36738649	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	36137488, 36738649	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	34002096	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER	—	GWAS catalog	34002096	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	31152163	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOBAL DEVELOPMENTAL DELAY	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLYCOSYLPHOSPHATIDYLINOSITOL BIOSYNTHESIS DEFECT 1	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLYCOSYLPHOSPHATIDYLINOSITOL BIOSYNTHESIS DEFECT 11	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	36137488, 39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	33686288, 35396580, 36137488, 39753749	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	33686288	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	32541925, 36738649, 38374256	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URANOSTAPHYLOSCHISIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Glioma	Glioma	Pubtator	25652157	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
GLYCOSYLPHOSPHATIDYLINOSITOL BIOSYNTHESIS DEFECT 11	Glycosylphosphatidylinositol deficiency	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	GWASCAT_DG	31152163		★★★★★ ★☆☆☆☆ Found in Text Mining only

MYO19 (myosin XIX)

Bookmark This Gene