MIF (macrophage migration inhibitory factor)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 4282
• Gene name: Macrophage migration inhibitory factor
• Gene symbol: MIF
• Synonyms (NCBI Gene): GIF, GLIF, MMIF
• Chromosome: 22
• Chromosome location: 22q11.23
• Summary: This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This l

miRNA Show/Hide all (56)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000664	hsa-miR-338-3p	Review	19935707
MIRT000046	hsa-miR-451a	Review	20026422
MIRT000046	hsa-miR-451a	ELISA, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	19318487
MIRT000046	hsa-miR-451a	ELISA, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	19318487
MIRT044670	hsa-miR-320a	CLASH	23622248
MIRT039145	hsa-miR-769-5p	CLASH	23622248
MIRT037678	hsa-miR-744-5p	CLASH	23622248
MIRT000046	hsa-miR-451a	Luciferase reporter assay, Western blot	24138931
MIRT000046	hsa-miR-451a	Luciferase reporter assay	26884830
MIRT000046	hsa-miR-451a	Luciferase reporter assay	28086136
MIRT000046	hsa-miR-451a	Luciferase reporter assay	28086136
MIRT000046	hsa-miR-451a	RNA-seq	33804111
MIRT733489	hsa-miR-1246	qRT-PCR, Western blotting	34112884
MIRT000046	hsa-miR-451a	qRT-PCR, Western blotting	34112884
MIRT734259	hsa-miR-654-5p	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	31608058
MIRT000046	hsa-miR-451a	Luciferase reporter assay	38379319
MIRT1149085	hsa-miR-1324	CLIP-seq
MIRT1149086	hsa-miR-1537	CLIP-seq
MIRT1149087	hsa-miR-2277-3p	CLIP-seq
MIRT1149088	hsa-miR-3166	CLIP-seq
MIRT1149089	hsa-miR-3170	CLIP-seq
MIRT1149090	hsa-miR-342-5p	CLIP-seq
MIRT1149091	hsa-miR-3960	CLIP-seq
MIRT1149092	hsa-miR-451	CLIP-seq
MIRT1149093	hsa-miR-4532	CLIP-seq
MIRT1149094	hsa-miR-4651	CLIP-seq
MIRT1149095	hsa-miR-4664-5p	CLIP-seq
MIRT1149096	hsa-miR-4713-5p	CLIP-seq
MIRT1149097	hsa-miR-4738-5p	CLIP-seq
MIRT1149098	hsa-miR-4773	CLIP-seq
MIRT1149099	hsa-miR-541	CLIP-seq
MIRT1149100	hsa-miR-608	CLIP-seq
MIRT1149085	hsa-miR-1324	CLIP-seq
MIRT1149086	hsa-miR-1537	CLIP-seq
MIRT1149087	hsa-miR-2277-3p	CLIP-seq
MIRT1149088	hsa-miR-3166	CLIP-seq
MIRT1149089	hsa-miR-3170	CLIP-seq
MIRT1149090	hsa-miR-342-5p	CLIP-seq
MIRT1149091	hsa-miR-3960	CLIP-seq
MIRT2042438	hsa-miR-4286	CLIP-seq
MIRT1149092	hsa-miR-451	CLIP-seq
MIRT1149093	hsa-miR-4532	CLIP-seq
MIRT1149094	hsa-miR-4651	CLIP-seq
MIRT1149095	hsa-miR-4664-5p	CLIP-seq
MIRT1149096	hsa-miR-4713-5p	CLIP-seq
MIRT1149097	hsa-miR-4738-5p	CLIP-seq
MIRT1149098	hsa-miR-4773	CLIP-seq
MIRT1149099	hsa-miR-541	CLIP-seq
MIRT1149100	hsa-miR-608	CLIP-seq
MIRT1149085	hsa-miR-1324	CLIP-seq
MIRT1149087	hsa-miR-2277-3p	CLIP-seq
MIRT1149088	hsa-miR-3166	CLIP-seq
MIRT1149091	hsa-miR-3960	CLIP-seq
MIRT1149093	hsa-miR-4532	CLIP-seq
MIRT1149097	hsa-miR-4738-5p	CLIP-seq
MIRT1149098	hsa-miR-4773	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HBP1	Repression	20383199
HIF1A	Activation	20727156
NFKB1	Unknown	18710704
RELA	Unknown	18710704
SP1	Activation	18034423

Gene ontology (GO) Show/Hide all (73)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001516	Process	Prostaglandin biosynthetic process	IDA	12782713
GO:0001819	Process	Positive regulation of cytokine production	IDA	19602265
GO:0002020	Function	Protease binding	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002906	Process	Negative regulation of mature B cell apoptotic process	IEA
GO:0004167	Function	Dopachrome isomerase activity	IDA	17526494
GO:0004167	Function	Dopachrome isomerase activity	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	12782713
GO:0005125	Function	Cytokine activity	IEA
GO:0005126	Function	Cytokine receptor binding	IDA	21817065
GO:0005126	Function	Cytokine receptor binding	IPI	17045821
GO:0005515	Function	Protein binding	IPI	12681488, 17526494, 18677096, 25416956, 26280537, 28726057, 31515488
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IDA	12782713
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	21817065
GO:0005615	Component	Extracellular space	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	24569872
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA	24569872
GO:0006954	Process	Inflammatory response	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IDA	12782713
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	10562313
GO:0009986	Component	Cell surface	IDA	12782713
GO:0010629	Process	Negative regulation of gene expression	IDA	10562313
GO:0010760	Process	Negative regulation of macrophage chemotaxis	IDA	21817065
GO:0016853	Function	Isomerase activity	IEA
GO:0019752	Process	Carboxylic acid metabolic process	IDA	12782713
GO:0030330	Process	DNA damage response, signal transduction by p53 class mediator	IEA
GO:0030336	Process	Negative regulation of cell migration	IMP	22952837
GO:0030890	Process	Positive regulation of B cell proliferation	IDA	12782713
GO:0031666	Process	Positive regulation of lipopolysaccharide-mediated signaling pathway	IEA
GO:0031982	Component	Vesicle	HDA	19190083
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	21817065
GO:0033033	Process	Negative regulation of myeloid cell apoptotic process	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0042056	Function	Chemoattractant activity	IDA	19602265
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042327	Process	Positive regulation of phosphorylation	IDA	12782713
GO:0042802	Function	Identical protein binding	IPI	20534506, 25416956, 31515488, 32296183
GO:0043030	Process	Regulation of macrophage activation	NAS	12782713
GO:0043066	Process	Negative regulation of apoptotic process	IDA	12782713
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	IDA	17045821
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IDA	12782713
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0050178	Function	Phenylpyruvate tautomerase activity	IBA
GO:0050178	Function	Phenylpyruvate tautomerase activity	IDA	16285950, 21817065
GO:0050178	Function	Phenylpyruvate tautomerase activity	IEA
GO:0050918	Process	Positive chemotaxis	IEA
GO:0051248	Process	Negative regulation of protein metabolic process	IEA
GO:0061078	Process	Positive regulation of prostaglandin secretion involved in immune response	IEA
GO:0061081	Process	Positive regulation of myeloid leukocyte cytokine production involved in immune response	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0070207	Process	Protein homotrimerization	IPI	17526494
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	12782713, 17045821
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IGI	21817065
GO:0080135	Process	Regulation of cellular response to stress	IEA
GO:0090238	Process	Positive regulation of arachidonate secretion	IEA
GO:0090398	Process	Cellular senescence	IEA
GO:0141163	Process	Positive regulation of cAMP/PKA signal transduction	IDA	17045821
GO:1902166	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IDA	17045821
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:2000343	Process	Positive regulation of chemokine (C-X-C motif) ligand 2 production	IEA
GO:2000773	Process	Negative regulation of cellular senescence	IDA	10562313

Other IDs

• MIM: 153620
• HGNC: 7097
• e!Ensembl: ENSG00000240972

Protein

• UniProt ID: P14174
• Protein name: Macrophage migration inhibitory factor (MIF) (EC 5.3.2.1) (Glycosylation-inhibiting factor) (GIF) (L-dopachrome isomerase) (L-dopachrome tautomerase) (EC 5.3.3.12) (Phenylpyruvate tautomerase)
• Protein function: Pro-inflammatory cytokine involved in the innate immune response to bacterial pathogens (PubMed:15908412, PubMed:17443469, PubMed:23776208). The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of
• PDB: 1CA7 , 1CGQ , 1GCZ , 1GD0 , 1GIF , 1LJT , 1MIF , 1P1G , 2OOH , 2OOW , 2OOZ , 3B9S , 3CE4 , 3DJH , 3DJI , 3HOF , 3IJG , 3IJJ , 3JSF , 3JSG , 3JTU , 3L5P , 3L5R , 3L5S , 3L5T , 3L5U , 3L5V , 3SMB , 3SMC , 3U18 , 3WNR , 3WNS , 3WNT , 4ETG , 4EUI , 4EVG , 4F2K , 4GRN , 4GRO , 4GRP , 4GRQ , 4GRR , 4GRU , 4GUM , 4K9G , 4OSF , 4OYQ , 4P01 , 4P0H , 4PKK , 4PKZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01187	MIF	2 → 115	Macrophage migration inhibitory factor (MIF)	Domain

• Sequence:

  MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
  SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

• Sequence length: 115

Pathways

KEGG Pathway	Reactome Pathway
Tyrosine metabolism	Cell surface interactions at the vascular wall
Phenylalanine metabolism	Neutrophil degranulation
Metabolic pathways	Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (37)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ANXIETY DISORDERS	—	CTD, Disgenet CTD, Disgenet	20177408	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	16872482	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	30503813	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	18676531	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	19602265	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	12376462	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS	—	CTD, Disgenet CTD, Disgenet	12105854	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTIC FIBROSIS	—	CTD, Disgenet, Orphanet CTD, Disgenet, Orphanet CTD, Disgenet, Orphanet	16179637	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	CTD	20177408	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma susceptibility 1	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	20177408	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	25162674	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIF-related disorder	Likely benign; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	17728788	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE	—	CTD	26752192	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS, SYSTEMIC JUVENILE	—	CTD, Disgenet CTD, Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPSIS	—	CTD, Disgenet CTD, Disgenet	9892616	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	CTD, Disgenet CTD, Disgenet	9372356	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC-ONSET JUVENILE IDIOPATHIC ARTHRITIS	—	ClinVar, Orphanet ClinVar, Orphanet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

Sort by: Blended Diseases Pathways Evidence source

MDK 3 shared diseasesAnxiety disorder, Memory disorders, Mesothelioma 5 shared evidence sourcesDisgenet (Anxiety disorder), CTD (Anxiety disorder), CTD (Memory disorders), Disgenet (Memory disorders), CTD (Mesothelioma) Related via 3 shared diseases including Anxiety disorder, Memory disorders — evidence mostly CTD. SFTPD 3 shared diseasesLung disease, Obstructive airway disease, Chronic obstructive pulmonary disease 4 shared evidence sourcesDisgenet (Asthma), Disgenet (Lung disease), Disgenet (Obstructive airway disease), CTD (Chronic obstructive pulmonary disease) Related via 3 shared diseases including Lung disease, Obstructive airway disease — evidence mostly Disgenet. CXCL1 4 shared diseasesAnxiety disorder, Obstructive airway disease, Juvenile idiopathic arthritis, Chronic obstructive pulmonary disease 3 shared evidence sourcesDisgenet (Obstructive airway disease), Disgenet (Juvenile idiopathic arthritis), CTD (Chronic obstructive pulmonary disease) Related via 4 shared diseases including Anxiety disorder, Obstructive airway disease — evidence mostly Disgenet. EPHX1 5 shared diseasesCarcinoma, Obstructive airway disease, Cystic fibrosis, Mesothelioma, Chronic obstructive pulmonary disease 6 shared evidence sourcesDisgenet (Asthma), CTD (Carcinoma), Disgenet (Obstructive airway disease), Disgenet (Cystic fibrosis), CTD (Mesothelioma), CTD (Chronic obstructive pulmonary disease) Related via 5 shared diseases including Carcinoma, Obstructive airway disease — evidence mostly Disgenet. LBP 2 shared diseasesSepsis, Stevens-johnson syndrome 5 shared evidence sourcesDisgenet (Obesity), CTD (Sepsis), Disgenet (Sepsis), CTD (Stevens-johnson syndrome), Disgenet (Stevens-johnson syndrome) Related via 2 shared diseases including Sepsis, Stevens-johnson syndrome — evidence mostly Disgenet.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
MDK	3	["Anxiety disorder","Memory disorders","Mesothelioma"]	0	[]	5	["Disgenet (Anxiety disorder)","CTD (Anxiety disorder)","CTD (Memory disorders)","Disgenet (Memory disorders)","CTD (Mesothelioma)"]
SFTPD	3	["Lung disease","Obstructive airway disease","Chronic obstructive pulmonary disease"]	0	[]	4	["Disgenet (Asthma)","Disgenet (Lung disease)","Disgenet (Obstructive airway disease)","CTD (Chronic obstructive pulmonary disease)"]
CXCL1	4	["Anxiety disorder","Obstructive airway disease","Juvenile idiopathic arthritis","Chronic obstructive pulmonary disease"]	0	[]	3	["Disgenet (Obstructive airway disease)","Disgenet (Juvenile idiopathic arthritis)","CTD (Chronic obstructive pulmonary disease)"]
EPHX1	5	["Carcinoma","Obstructive airway disease","Cystic fibrosis","Mesothelioma","Chronic obstructive pulmonary disease"]	0	[]	6	["Disgenet (Asthma)","CTD (Carcinoma)","Disgenet (Obstructive airway disease)","Disgenet (Cystic fibrosis)","CTD (Mesothelioma)","CTD (Chronic obstructive pulmonary disease)"]
LBP	2	["Sepsis","Stevens-johnson syndrome"]	0	[]	5	["Disgenet (Obesity)","CTD (Sepsis)","Disgenet (Sepsis)","CTD (Stevens-johnson syndrome)","Disgenet (Stevens-johnson syndrome)"]

Diseases Linked via Similar Genes

Lung neoplasms Linked via 2 of 5 related genesSFTPD, EPHX1 Metabolic syndrome Linked via 2 of 5 related genesEPHX1, LBP Brain ischemia Linked via 1 of 5 related genesMDK Diabetic neuropathy Linked via 1 of 5 related genesMDK Glioma Linked via 1 of 5 related genesMDK

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Lung neoplasms	2	["SFTPD","EPHX1"]
Metabolic syndrome	2	["EPHX1","LBP"]
Brain ischemia	1	["MDK"]
Diabetic neuropathy	1	["MDK"]
Glioma	1	["MDK"]