Gene Gene information from NCBI Gene database.
Entrez ID 2919
Gene name C-X-C motif chemokine ligand 1
Gene symbol CXCL1
Synonyms (NCBI Gene)
FSPGRO1GROaMGSAMGSA-aNAP-3SCYB1
Chromosome 4
Chromosome location 4q13.3
Summary This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattra
miRNA miRNA information provided by mirtarbase database.
246
miRTarBase ID miRNA Experiments Reference
MIRT023084 hsa-miR-124-3p Microarray 18668037
MIRT023999 hsa-miR-1-3p Microarray 18668037
MIRT613684 hsa-miR-27b-5p HITS-CLIP 23824327
MIRT613684 hsa-miR-27b-5p HITS-CLIP 23824327
MIRT613684 hsa-miR-27b-5p HITS-CLIP 23824327
Transcription factors Transcription factors information provided by TRRUST V2 database.
10
Transcription factor Regulation Reference
BRCA1 Repression 22120723
CEBPD Activation 23028973
GATA3 Repression 22120723
HMGA1 Unknown 11112786;7479086
NFKB1 Activation 10530453;15958549
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
29
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding TAS 9079638, 10820279
GO:0005125 Function Cytokine activity IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
155730 4602 ENSG00000163739
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P09341
Protein name Growth-regulated alpha protein (C-X-C motif chemokine 1) (GRO-alpha(1-73)) (Melanoma growth stimulatory activity) (MGSA) (Neutrophil-activating protein 3) (NAP-3) [Cleaved into: GRO-alpha(4-73); GRO-alpha(5-73); GRO-alpha(6-73)]
Protein function Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold high
PDB 1MGS , 1MSG , 1MSH , 1ROD , 8K4O , 8XWA , 8XWV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 41 100 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Sequence
MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSV
NVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKM
LNSDKSN
Sequence length 107
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
15
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ANXIETY DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ARTHRITIS, JUVENILE CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE CHRONIC HEPATITIS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE HEPATITIS WITH CENTRILOBULAR NECROSIS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute pancreatitis Pancreatitis BEFREE 31726046
★☆☆☆☆
Found in Text Mining only
Adamantinous Craniopharyngioma Adamantinous Craniopharyngioma BEFREE 31249603
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of large intestine Colorectal Cancer BEFREE 28983473
★☆☆☆☆
Found in Text Mining only
Adenoma Adenoma BEFREE 11524231, 26208990
★☆☆☆☆
Found in Text Mining only
Adenoma of large intestine Colorectal adenoma BEFREE 18578857, 26208990
★☆☆☆☆
Found in Text Mining only
Age related macular degeneration Age-related macular degeneration BEFREE 28765149
★☆☆☆☆
Found in Text Mining only
Alopecia Alopecia BEFREE 26345899
★☆☆☆☆
Found in Text Mining only
Alopecia Areata Alopecia Areata BEFREE 26345899
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 38178159, 40613333 Associate
★☆☆☆☆
Found in Text Mining only
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis BEFREE 27812125
★☆☆☆☆
Found in Text Mining only