Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	2919
Gene name	C-X-C motif chemokine ligand 1
Gene symbol	CXCL1
Synonyms (NCBI Gene)	FSPGRO1GROaMGSAMGSA-aNAP-3SCYB1
Chromosome	4
Chromosome location	4q13.3
Summary	This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattra

246

Show/Hide all (246)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023084	hsa-miR-124-3p	Microarray	18668037
MIRT023999	hsa-miR-1-3p	Microarray	18668037
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT734007	hsa-miR-302e	Luciferase reporter assayqRT-PCRWestern blotting	34079750
MIRT613684	hsa-miR-27b-5p	Luciferase reporter assayqRT-PCR	32782028
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT613684	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT756129	hsa-miR-34c-5p	Luciferase reporter assayMicroarrayqRT-PCRImmunofluorescenceELISA	36829591
MIRT756130	hsa-miR-34b-5p	Luciferase reporter assayMicroarrayqRT-PCRImmunofluorescenceELISA	36829591
MIRT917939	hsa-miR-371-5p	CLIP-seq
MIRT1972088	hsa-miR-1184	CLIP-seq
MIRT1972089	hsa-miR-1205	CLIP-seq
MIRT1972090	hsa-miR-1301	CLIP-seq
MIRT1972091	hsa-miR-3158-5p	CLIP-seq
MIRT1972092	hsa-miR-3545-3p	CLIP-seq
MIRT1972093	hsa-miR-4517	CLIP-seq
MIRT1972094	hsa-miR-4660	CLIP-seq
MIRT1972095	hsa-miR-4757-5p	CLIP-seq
MIRT1972096	hsa-miR-5047	CLIP-seq
MIRT2207914	hsa-miR-181a	CLIP-seq
MIRT2207915	hsa-miR-181b	CLIP-seq
MIRT2207916	hsa-miR-181c	CLIP-seq
MIRT2207917	hsa-miR-181d	CLIP-seq
MIRT2207918	hsa-miR-4262	CLIP-seq
MIRT2436544	hsa-miR-1237	CLIP-seq
MIRT2436545	hsa-miR-3155	CLIP-seq
MIRT2436546	hsa-miR-3155b	CLIP-seq
MIRT2436547	hsa-miR-3622b-5p	CLIP-seq
MIRT2436548	hsa-miR-4268	CLIP-seq
MIRT2436549	hsa-miR-4287	CLIP-seq
MIRT2436550	hsa-miR-4684-3p	CLIP-seq
MIRT2436551	hsa-miR-4685-3p	CLIP-seq
MIRT2436552	hsa-miR-4691-5p	CLIP-seq
MIRT2436553	hsa-miR-484	CLIP-seq
MIRT2436554	hsa-miR-516a-3p	CLIP-seq
MIRT1972088	hsa-miR-1184	CLIP-seq
MIRT2511174	hsa-miR-1197	CLIP-seq
MIRT1972089	hsa-miR-1205	CLIP-seq
MIRT2511175	hsa-miR-1273e	CLIP-seq
MIRT2511176	hsa-miR-128	CLIP-seq
MIRT1972090	hsa-miR-1301	CLIP-seq
MIRT2511177	hsa-miR-1305	CLIP-seq
MIRT2511178	hsa-miR-141	CLIP-seq
MIRT2207914	hsa-miR-181a	CLIP-seq
MIRT2207915	hsa-miR-181b	CLIP-seq
MIRT2207916	hsa-miR-181c	CLIP-seq
MIRT2207917	hsa-miR-181d	CLIP-seq
MIRT2511179	hsa-miR-186	CLIP-seq
MIRT2511180	hsa-miR-200a	CLIP-seq
MIRT2511181	hsa-miR-2116	CLIP-seq
MIRT2511182	hsa-miR-2682	CLIP-seq
MIRT2511183	hsa-miR-27a	CLIP-seq
MIRT2511184	hsa-miR-27b	CLIP-seq
MIRT2511185	hsa-miR-3143	CLIP-seq
MIRT2511186	hsa-miR-3145-3p	CLIP-seq
MIRT2436545	hsa-miR-3155	CLIP-seq
MIRT2436546	hsa-miR-3155b	CLIP-seq
MIRT1972091	hsa-miR-3158-5p	CLIP-seq
MIRT2511187	hsa-miR-3163	CLIP-seq
MIRT2511188	hsa-miR-3168	CLIP-seq
MIRT2511189	hsa-miR-3170	CLIP-seq
MIRT2511190	hsa-miR-3187-3p	CLIP-seq
MIRT2511191	hsa-miR-3194-5p	CLIP-seq
MIRT2511192	hsa-miR-331-3p	CLIP-seq
MIRT1972092	hsa-miR-3545-3p	CLIP-seq
MIRT2511193	hsa-miR-3607-3p	CLIP-seq
MIRT2511194	hsa-miR-3613-3p	CLIP-seq
MIRT2511195	hsa-miR-3617	CLIP-seq
MIRT2511196	hsa-miR-3622a-5p	CLIP-seq
MIRT2436547	hsa-miR-3622b-5p	CLIP-seq
MIRT2511197	hsa-miR-3652	CLIP-seq
MIRT2511198	hsa-miR-3662	CLIP-seq
MIRT2511199	hsa-miR-3665	CLIP-seq
MIRT2511200	hsa-miR-3671	CLIP-seq
MIRT2511201	hsa-miR-369-3p	CLIP-seq
MIRT2511202	hsa-miR-3714	CLIP-seq
MIRT2511203	hsa-miR-374a	CLIP-seq
MIRT2511204	hsa-miR-374b	CLIP-seq
MIRT2511205	hsa-miR-3927	CLIP-seq
MIRT2511206	hsa-miR-3944-5p	CLIP-seq
MIRT2511207	hsa-miR-409-3p	CLIP-seq
MIRT2511208	hsa-miR-421	CLIP-seq
MIRT2207918	hsa-miR-4262	CLIP-seq
MIRT2436548	hsa-miR-4268	CLIP-seq
MIRT2436549	hsa-miR-4287	CLIP-seq
MIRT2511209	hsa-miR-4297	CLIP-seq
MIRT2511210	hsa-miR-4302	CLIP-seq
MIRT2511211	hsa-miR-4423-3p	CLIP-seq
MIRT2511212	hsa-miR-4424	CLIP-seq
MIRT2511213	hsa-miR-4430	CLIP-seq
MIRT2511214	hsa-miR-4434	CLIP-seq
MIRT2511215	hsa-miR-4435	CLIP-seq
MIRT2511216	hsa-miR-4451	CLIP-seq
MIRT2511217	hsa-miR-449c	CLIP-seq
MIRT2511218	hsa-miR-4505	CLIP-seq
MIRT2511219	hsa-miR-4516	CLIP-seq
MIRT1972093	hsa-miR-4517	CLIP-seq
MIRT2511220	hsa-miR-4529-5p	CLIP-seq
MIRT2511221	hsa-miR-4531	CLIP-seq
MIRT2511222	hsa-miR-4633-5p	CLIP-seq
MIRT2511223	hsa-miR-4637	CLIP-seq
MIRT1972094	hsa-miR-4660	CLIP-seq
MIRT2436550	hsa-miR-4684-3p	CLIP-seq
MIRT2436551	hsa-miR-4685-3p	CLIP-seq
MIRT2436552	hsa-miR-4691-5p	CLIP-seq
MIRT2511224	hsa-miR-4695-3p	CLIP-seq
MIRT2511225	hsa-miR-4701-5p	CLIP-seq
MIRT2511226	hsa-miR-4720-5p	CLIP-seq
MIRT2511227	hsa-miR-4724-3p	CLIP-seq
MIRT1972095	hsa-miR-4757-5p	CLIP-seq
MIRT2511228	hsa-miR-4773	CLIP-seq
MIRT2511229	hsa-miR-4799-3p	CLIP-seq
MIRT2511230	hsa-miR-4803	CLIP-seq
MIRT2436553	hsa-miR-484	CLIP-seq
MIRT2511231	hsa-miR-487a	CLIP-seq
MIRT2511232	hsa-miR-489	CLIP-seq
MIRT1972096	hsa-miR-5047	CLIP-seq
MIRT2511233	hsa-miR-513b	CLIP-seq
MIRT2436554	hsa-miR-516a-3p	CLIP-seq
MIRT2511234	hsa-miR-520d-5p	CLIP-seq
MIRT2511235	hsa-miR-524-5p	CLIP-seq
MIRT2511236	hsa-miR-532-5p	CLIP-seq
MIRT2511237	hsa-miR-539	CLIP-seq
MIRT2511238	hsa-miR-543	CLIP-seq
MIRT2511239	hsa-miR-548a-3p	CLIP-seq
MIRT2511240	hsa-miR-548e	CLIP-seq
MIRT2511241	hsa-miR-548f	CLIP-seq
MIRT2511242	hsa-miR-548s	CLIP-seq
MIRT2511243	hsa-miR-561	CLIP-seq
MIRT2511244	hsa-miR-563	CLIP-seq
MIRT2511245	hsa-miR-570	CLIP-seq
MIRT2511246	hsa-miR-576-3p	CLIP-seq
MIRT2511247	hsa-miR-588	CLIP-seq
MIRT2511248	hsa-miR-607	CLIP-seq
MIRT2511249	hsa-miR-641	CLIP-seq
MIRT2511250	hsa-miR-648	CLIP-seq
MIRT2511251	hsa-miR-657	CLIP-seq
MIRT2511252	hsa-miR-935	CLIP-seq
MIRT2511253	hsa-miR-944	CLIP-seq
MIRT1972088	hsa-miR-1184	CLIP-seq
MIRT2511174	hsa-miR-1197	CLIP-seq
MIRT1972089	hsa-miR-1205	CLIP-seq
MIRT2436544	hsa-miR-1237	CLIP-seq
MIRT2678849	hsa-miR-1238	CLIP-seq
MIRT2511175	hsa-miR-1273e	CLIP-seq
MIRT2511176	hsa-miR-128	CLIP-seq
MIRT1972090	hsa-miR-1301	CLIP-seq
MIRT2511177	hsa-miR-1305	CLIP-seq
MIRT2207914	hsa-miR-181a	CLIP-seq
MIRT2207915	hsa-miR-181b	CLIP-seq
MIRT2207916	hsa-miR-181c	CLIP-seq
MIRT2207917	hsa-miR-181d	CLIP-seq
MIRT2511179	hsa-miR-186	CLIP-seq
MIRT2678850	hsa-miR-205	CLIP-seq
MIRT2511181	hsa-miR-2116	CLIP-seq
MIRT2511183	hsa-miR-27a	CLIP-seq
MIRT2511184	hsa-miR-27b	CLIP-seq
MIRT2678851	hsa-miR-3124-3p	CLIP-seq
MIRT2511185	hsa-miR-3143	CLIP-seq
MIRT2511186	hsa-miR-3145-3p	CLIP-seq
MIRT2436545	hsa-miR-3155	CLIP-seq
MIRT2436546	hsa-miR-3155b	CLIP-seq
MIRT1972091	hsa-miR-3158-5p	CLIP-seq
MIRT2511187	hsa-miR-3163	CLIP-seq
MIRT2511188	hsa-miR-3168	CLIP-seq
MIRT2511189	hsa-miR-3170	CLIP-seq
MIRT2511190	hsa-miR-3187-3p	CLIP-seq
MIRT2511191	hsa-miR-3194-5p	CLIP-seq
MIRT2511192	hsa-miR-331-3p	CLIP-seq
MIRT1972092	hsa-miR-3545-3p	CLIP-seq
MIRT2511194	hsa-miR-3613-3p	CLIP-seq
MIRT2436547	hsa-miR-3622b-5p	CLIP-seq
MIRT2511197	hsa-miR-3652	CLIP-seq
MIRT2511198	hsa-miR-3662	CLIP-seq
MIRT2511199	hsa-miR-3665	CLIP-seq
MIRT2511200	hsa-miR-3671	CLIP-seq
MIRT2511201	hsa-miR-369-3p	CLIP-seq
MIRT2511203	hsa-miR-374a	CLIP-seq
MIRT2511204	hsa-miR-374b	CLIP-seq
MIRT2678852	hsa-miR-3918	CLIP-seq
MIRT2511205	hsa-miR-3927	CLIP-seq
MIRT2511206	hsa-miR-3944-5p	CLIP-seq
MIRT2511207	hsa-miR-409-3p	CLIP-seq
MIRT2511208	hsa-miR-421	CLIP-seq
MIRT2207918	hsa-miR-4262	CLIP-seq
MIRT2436548	hsa-miR-4268	CLIP-seq
MIRT2436549	hsa-miR-4287	CLIP-seq
MIRT2511209	hsa-miR-4297	CLIP-seq
MIRT2511210	hsa-miR-4302	CLIP-seq
MIRT2511212	hsa-miR-4424	CLIP-seq
MIRT2511213	hsa-miR-4430	CLIP-seq
MIRT2511214	hsa-miR-4434	CLIP-seq
MIRT2511215	hsa-miR-4435	CLIP-seq
MIRT2511216	hsa-miR-4451	CLIP-seq
MIRT2511218	hsa-miR-4505	CLIP-seq
MIRT2678853	hsa-miR-4512	CLIP-seq
MIRT2511219	hsa-miR-4516	CLIP-seq
MIRT1972093	hsa-miR-4517	CLIP-seq
MIRT2511220	hsa-miR-4529-5p	CLIP-seq
MIRT2511221	hsa-miR-4531	CLIP-seq
MIRT2511223	hsa-miR-4637	CLIP-seq
MIRT1972094	hsa-miR-4660	CLIP-seq
MIRT2436550	hsa-miR-4684-3p	CLIP-seq
MIRT2436551	hsa-miR-4685-3p	CLIP-seq
MIRT2678854	hsa-miR-4691-3p	CLIP-seq
MIRT2436552	hsa-miR-4691-5p	CLIP-seq
MIRT2511224	hsa-miR-4695-3p	CLIP-seq
MIRT2511225	hsa-miR-4701-5p	CLIP-seq
MIRT2678855	hsa-miR-4711-3p	CLIP-seq
MIRT2511226	hsa-miR-4720-5p	CLIP-seq
MIRT2511227	hsa-miR-4724-3p	CLIP-seq
MIRT2678856	hsa-miR-4753-3p	CLIP-seq
MIRT1972095	hsa-miR-4757-5p	CLIP-seq
MIRT2511228	hsa-miR-4773	CLIP-seq
MIRT2511229	hsa-miR-4799-3p	CLIP-seq
MIRT2511230	hsa-miR-4803	CLIP-seq
MIRT2436553	hsa-miR-484	CLIP-seq
MIRT2511231	hsa-miR-487a	CLIP-seq
MIRT2511232	hsa-miR-489	CLIP-seq
MIRT1972096	hsa-miR-5047	CLIP-seq
MIRT2511233	hsa-miR-513b	CLIP-seq
MIRT2436554	hsa-miR-516a-3p	CLIP-seq
MIRT2511234	hsa-miR-520d-5p	CLIP-seq
MIRT2511235	hsa-miR-524-5p	CLIP-seq
MIRT2511237	hsa-miR-539	CLIP-seq
MIRT2511238	hsa-miR-543	CLIP-seq
MIRT2511242	hsa-miR-548s	CLIP-seq
MIRT2511243	hsa-miR-561	CLIP-seq
MIRT2511244	hsa-miR-563	CLIP-seq
MIRT2511245	hsa-miR-570	CLIP-seq
MIRT2511246	hsa-miR-576-3p	CLIP-seq
MIRT2511247	hsa-miR-588	CLIP-seq
MIRT2678857	hsa-miR-593	CLIP-seq
MIRT2678858	hsa-miR-603	CLIP-seq
MIRT2511248	hsa-miR-607	CLIP-seq
MIRT2511250	hsa-miR-648	CLIP-seq
MIRT2511251	hsa-miR-657	CLIP-seq
MIRT2678859	hsa-miR-873	CLIP-seq
MIRT2511252	hsa-miR-935	CLIP-seq

Show/Hide all (10)

Transcription factor	Regulation	Reference
BRCA1	Repression	22120723
CEBPD	Activation	23028973
GATA3	Repression	22120723
HMGA1	Unknown	11112786;7479086
NFKB1	Activation	10530453;15958549
NFKB1	Unknown	11112786;16040075;7479086
PARP1	Unknown	11112786
RELA	Activation	10530453;15958549
RELA	Unknown	11112786;16040075
SP1	Unknown	11112786;7479086

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	TAS	9079638, 10820279
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	10881932
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	10820279
GO:0006952	Process	Defense response	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	TAS	9725262
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	TAS	9725262, 10820279
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10820279
GO:0007399	Process	Nervous system development	TAS	9058825
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	TAS	10820279
GO:0008047	Function	Enzyme activator activity	TAS	9079638
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	TAS	8380167
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9551928
GO:0030036	Process	Actin cytoskeleton organization	TAS	9725262
GO:0031640	Process	Killing of cells of another organism	IDA	12949249
GO:0035556	Process	Intracellular signal transduction	TAS	9551928
GO:0035580	Component	Specific granule lumen	TAS
GO:0060326	Process	Cell chemotaxis	IEA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12949249
GO:1904724	Component	Tertiary granule lumen	TAS

MIM	HGNC	e!Ensembl
155730	4602	ENSG00000163739

P09341

Protein name

Growth-regulated alpha protein (C-X-C motif chemokine 1) (GRO-alpha(1-73)) (Melanoma growth stimulatory activity) (MGSA) (Neutrophil-activating protein 3) (NAP-3) [Cleaved into: GRO-alpha(4-73); GRO-alpha(5-73); GRO-alpha(6-73)]

Protein function

Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold high

PDB

1MGS , 1MSG , 1MSH , 1ROD , 8K4O , 8XWA , 8XWV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00048	IL8	41 → 100	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

Sequence

MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSV
NVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Sequence length

107

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANXIETY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, JUVENILE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE CHRONIC HEPATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE HEPATITIS WITH CENTRILOBULAR NECROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHIAL HYPERREACTIVITY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, AUTOIMMUNE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (331)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute pancreatitis	Pancreatitis	BEFREE	31726046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adamantinous Craniopharyngioma	Adamantinous Craniopharyngioma	BEFREE	31249603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	28983473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11524231, 26208990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	18578857, 26208990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	28765149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	26345899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	26345899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	38178159, 40613333	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	27812125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	28437540	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	21383500		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30021140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	39991758	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Rupture	Aortic Rupture	BEFREE	25563839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	25386842, 26483345, 26837267, 28637660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	10881738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	28012239, 34963488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	10086850, 1732389, 35055107, 9424095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	8245503	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10337033, 10437780, 28850672	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	18205922, 28708839, 33066816, 33087182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	10881738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	18774390, 20371397, 34727921, 36197221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	19017877	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	25748343, 27188427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	40696647	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	17709400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	17456471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	25386842, 26483345, 26837267, 28637660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	32383373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	CTD_human_DG	21227906		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	23190644, 25386842		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28416308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	27733093		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	24894780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	18451219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	27690238, 28285559, 28423359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15994930, 17379503, 22408746, 23042094, 24484937, 25344051, 26397389, 29109519, 29273624, 29387062, 29438938, 29495008, 30028224, 30094610, 30158589, 30405845, 31803057 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18045955, 18248671, 19451693, 25344051, 29495008, 36581948, 39287311	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20030852, 39518934	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28560447, 31322183	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	CTD_human_DG	12388339		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	11371564, 17060621, 23815949, 29784873, 34218518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25485576	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	28575019, 30094610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24260493, 26503598, 29962817, 36411463, 36975480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36938723	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	27690238, 28285559, 28423359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23665907, 25301363, 27446967, 30158168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32481352, 37540227, 37622107	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	23890481	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	19608731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	17060621, 20702723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	36035865	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	28637660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	18205922, 31981738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Aneurysm	Cerebral Aneurysm	BEFREE	25922506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	30872008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	31183363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	24619879	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	35377900	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	35218958	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	CTD_human_DG	23099361		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	26747783, 27516147, 30395484, 30676127		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Periodontitis	Periodontitis	Pubtator	30760334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	22173151, 24260493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	30227886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	31105713, 31194881, 31634391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	32190668, 33462173, 34717557, 36854781, 38070204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	1341267, 15787094, 17062666, 27092462, 30115896, 30232275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	27956697, 30782668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	32788867, 34473751, 35958781, 36246978, 38031087	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	38297356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16567391, 18578857, 24999605, 26104296, 26208990, 27472713, 28455419, 28870907, 29784873, 30705034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16101183, 18578857, 19957108, 21285972, 23155391, 26208990, 27091625, 27472713, 29784873, 30973890, 31137244, 31893510, 32058945, 32351322, 32462020 View all (8 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32337262, 34233297, 36434686	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	19957108	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30119177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	28584076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	12871498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	12871498	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	28842514	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	28859336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	16776676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	27267052, 34106269, 37496049, 39475676	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	28613228, 28972805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	19399182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	27799352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	30905425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	Pubtator	30905425	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	33848079	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	36045687	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	10229398, 10881738, 21134476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	20848487, 29945876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	17594598	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	29410948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30826620, 31034777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	26171980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	28528167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Allergic Contact	Allergic contact dermatitis	Pubtator	39408763	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	22272250, 25315214, 27304428	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	31892708	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	28820395, 30223113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Irritant	Dermatitis	BEFREE	27269729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	LHGDN	15492419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	28820395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	31404587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31404587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	39966757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	35381625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	40127075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28760408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic ketoacidosis	Pubtator	24619879	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	32778679, 37986381, 38206700	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic neuropathy	Pubtator	17594598	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	30227886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Dyskeratosis congenita	Pubtator	37717172	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	BEFREE	2095366, 27377700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	28820395, 30223113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	23382563, 29678185, 31283843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	19549892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	22615136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	12012624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	30475413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	34269788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	39343172	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31699822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	34555062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	20702723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	19435811, 26458866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	19435811, 26458866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	28518141, 34218518, 34404882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Mediterranean Fever	Familial mediterranean fever	Pubtator	39440870	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	31705800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	31585800, 31705800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	24940801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	37268663	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	40613333	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	11091274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	25120735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized pustular psoriasis	Pustular Psoriasis	BEFREE	29871627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32534425, 33571109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26398661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30379898	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	29791907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	24023680	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	28765149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	14688376	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	11112786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	9424095	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	25114117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome, Familial	Guillain-Barre Syndrome	BEFREE	25114117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	23979133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	29514257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	39966757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	29784904	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30119177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	35185912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	27655254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	26314558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	12734381	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	39595551	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29170451, 29514257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	25279550	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	20729179	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis	Ichthyosis	Pubtator	27554821	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30119177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	32899090	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	25471749, 28969604		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ileus	Ileus	BEFREE	31722447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	17942898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	32020185, 38199515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	28528167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	29372285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35042389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disk Displacement	Intervertebral Disk Displacement	BEFREE	12131709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Intestinal polyposis	Pubtator	38297356	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	23198952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	28012239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	LHGDN	12388718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	19642907, 30690344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	18753296, 31812015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	37540227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	37554265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	19388934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	30123289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	31752148, 31818168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	40613333	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	15218300, 26462152, 30035347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24260493, 25944999, 26503598, 27542259, 27682863, 29179487, 31021443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	22173151, 24260493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Alcoholic	Liver cirrhosis	Pubtator	24260493, 31637480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	34367180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	24260493, 31637480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	39619227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	31637480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	17227950, 27799352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	38158808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	37266432	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23665907, 38158808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	33685997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	25471749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20731665, 27472713, 27748927, 28575019, 35377900, 38158808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	30379898	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Majeed syndrome	Majeed syndrome	Pubtator	33314777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	30826620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	23979133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15994930, 17379503, 23042094, 24484937, 25344051, 26397389, 29109519, 29273624, 29387062, 29438938, 30028224, 30158589, 30405845, 31803057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	22615136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	19435811, 26458866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23665907, 26462152, 27446967, 30158168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	15218300, 26462152, 30035347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	17060621, 20702723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	27472713, 31807514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22290877, 23042094, 23334998, 24484937, 27241286, 30809313, 31500632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21343381, 27748927, 27832972, 30796034, 31638362, 31810929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	27577959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	27690238, 28285559, 28423359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16799643, 18056965, 19258312, 20596077, 22770218, 23027620, 23334998, 24999605, 27472713, 27690238, 27748927, 27956697, 28575019, 28874093, 29109519 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15787094, 17062666, 27092462, 30115896, 30232275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17999991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	18045955, 25344051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mannose-Binding Protein Deficiency	Mannose-Binding Protein Deficiency	BEFREE	31260126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	32539808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11030154, 11406569, 15218300, 15899804, 16452192, 19574933, 20030852, 20596077, 2095366, 22225770, 2970963, 30221044, 31374840, 7479086, 8264646, 8530498, 9230219 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11112213, 11773061, 1372901, 15899804, 16098041, 16799643, 20030852, 2217207, 22225770, 22441657, 25560632, 25944800, 2670560, 34799355, 35043517 View all (5 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11112786, 1732389, 30870978, 35538545, 7479086	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	16098041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	37481560	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30826620, 31034777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	31214186	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	26462152, 34384424	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	12808325, 15608388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	25268740, 32922167	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	16996102, 29697856, 29844175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	28045063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	28045063	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	25349304, 29445180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29430728, 30295758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	31772617, 32594092, 33847684, 39809140	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	40114239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	16608789, 19101504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	19178793	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	19608731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11030154, 1341267, 16567391, 16618733, 16799643, 17060621, 18056965, 18578857, 1861861, 18975380, 19258312, 19408311, 19549892, 19574933, 20596077 View all (33 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	34079083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	29179487, 31752148, 31818168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	22634316, 29368547, 30892082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25301363, 25349304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	27241286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29784904	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29887999, 33487124, 35894174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	30035347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	10437780	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	12483724, 21134476, 25279550, 33087182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	28829242, 31470613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	31665717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	17060621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	17060621, 20702723		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	17060621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17060621, 18719363, 21928244, 23300534, 24376747, 26462152, 27472713, 32326946, 32851734, 34995016, 35618786, 37787042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34794429	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	27472713, 31807514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	27472713, 29157747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	24476546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	34859622, 38206700	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	35154475	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	30991054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	30991054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	28575019	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	31652327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	24279306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	30872106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	31652327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	25766782, 31661651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22290877, 23042094, 23334998, 24484937, 27241286, 31500632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	30809313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31500632, 32339056, 39518934	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	1732389, 33416099, 36765431, 38003437, 38115636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28217129, 29167025, 31260126, 8875965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	25970596	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	20395558, 30395484, 30676127, 34145303, 34335580, 36017119	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	19155512, 31798831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyelonephritis	Pyelonephritis	BEFREE	30905425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma gangrenosum	Pubtator	24903614	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma gangrenosum	Pubtator	25501066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	BEFREE	25766782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhegmatogenous retinal detachment	Rhegmatogenous retinal detachment	BEFREE	25766782, 31661651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhegmatogenous Retinal Detachment Autosomal Dominant	Rhegmatogenous retinal detachment	Pubtator	25766782	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10229398, 10881738, 28708839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	30015110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	28870907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28922428, 29762676, 30489503, 30723078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	27623398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	28528167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	25301363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia	Spastic Paraplegia	BEFREE	8782167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic paraplegia 4 autosomal dominant	Spastic paraplegia	Pubtator	9507385	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15218300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15221009, 29360827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28518141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18254958, 21085979, 26462152, 36328378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31705800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21343381, 27748927, 27832972, 30796034, 31638362, 31810929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	14632759, 21343381, 23815949, 27748927, 28575019, 29283424, 36614235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20731665	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet syndrome	Pubtator	24903614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	30645172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	24894780	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	31801935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	19006565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytopenia Neonatal Alloimmune	Thrombocytopenia	Pubtator	9163597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	35515000	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	11524231, 27577959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	27577959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tonsillitis	Tonsillitis	Pubtator	15008987, 15807854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28560447	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28750689, 30034618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28750689, 33959656, 35377948	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	11181568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23815949, 29854840, 30816487, 34517533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28285559	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	35264061, 35764974	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	27942751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	25766782	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CXCL1 (C-X-C motif chemokine ligand 1)