LBP (lipopolysaccharide binding protein)

Gene

• Entrez ID: 3929
• Gene name: Lipopolysaccharide binding protein
• Gene symbol: LBP
• Synonyms (NCBI Gene): BPIFD2
• Chromosome: 20
• Chromosome location: 20q11.23
• Summary: The protein encoded by this gene is involved in the acute-phase immunologic response to gram-negative bacterial infections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Together with bactericidal permeab

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017289	hsa-miR-335-5p	Microarray	18185580
MIRT050450	hsa-miR-22-3p	CLASH	23622248
MIRT045133	hsa-miR-186-5p	CLASH	23622248
MIRT1105367	hsa-miR-4299	CLIP-seq
MIRT1105368	hsa-miR-4709-3p	CLIP-seq
MIRT1105369	hsa-miR-501-3p	CLIP-seq
MIRT1105370	hsa-miR-502-3p	CLIP-seq
MIRT1105371	hsa-miR-765	CLIP-seq
MIRT2560303	hsa-miR-1207-3p	CLIP-seq
MIRT2560304	hsa-miR-139-3p	CLIP-seq
MIRT2560305	hsa-miR-4267	CLIP-seq
MIRT2560306	hsa-miR-875-3p	CLIP-seq
MIRT2560303	hsa-miR-1207-3p	CLIP-seq
MIRT2560304	hsa-miR-139-3p	CLIP-seq
MIRT2683800	hsa-miR-3655	CLIP-seq
MIRT2560305	hsa-miR-4267	CLIP-seq
MIRT2683801	hsa-miR-578	CLIP-seq
MIRT2560306	hsa-miR-875-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
JUN	Repression	15114678

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001530	Function	Lipopolysaccharide binding	IBA
GO:0001530	Function	Lipopolysaccharide binding	IDA	12594207
GO:0001530	Function	Lipopolysaccharide binding	IEA
GO:0001530	Function	Lipopolysaccharide binding	IMP	24120359
GO:0001530	Function	Lipopolysaccharide binding	ISS	2477488
GO:0002232	Process	Leukocyte chemotaxis involved in inflammatory response	IEA
GO:0002281	Process	Macrophage activation involved in immune response	IBA
GO:0002281	Process	Macrophage activation involved in immune response	IEA
GO:0002281	Process	Macrophage activation involved in immune response	IMP	24120359
GO:0002281	Process	Macrophage activation involved in immune response	ISS	2402637
GO:0002376	Process	Immune system process	IEA
GO:0002752	Process	Cell surface pattern recognition receptor signaling pathway	IDA	15294986
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	ISS	2477488
GO:0005515	Function	Protein binding	IPI	21988832, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	2402637, 11528597, 24120359
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	ISS	2477488
GO:0006869	Process	Lipid transport	IEA
GO:0006953	Process	Acute-phase response	IBA
GO:0006953	Process	Acute-phase response	IEA
GO:0006953	Process	Acute-phase response	IEP	12932360
GO:0006953	Process	Acute-phase response	ISS	2477488
GO:0006968	Process	Cellular defense response	ISS	2402637
GO:0008228	Process	Opsonization	IC	12932360
GO:0008228	Process	Opsonization	ISS	2477488
GO:0008289	Function	Lipid binding	IEA
GO:0009986	Component	Cell surface	IDA	11528597
GO:0009986	Component	Cell surface	IEA
GO:0015026	Function	Coreceptor activity	IPI	15294986
GO:0015920	Process	Lipopolysaccharide transport	IDA	8985160
GO:0016020	Component	Membrane	IEA
GO:0030593	Process	Neutrophil chemotaxis	IEA
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IBA
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IDA	8409400, 11739189
GO:0032490	Process	Detection of molecule of bacterial origin	IDA	11528597
GO:0032496	Process	Response to lipopolysaccharide	IDA	8409400, 11739189
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IDA	11739189
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	8409400
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	8409400
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	12594207
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	8409400
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	24120359
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS	2402637
GO:0034145	Process	Positive regulation of toll-like receptor 4 signaling pathway	IDA	11528597
GO:0042742	Process	Defense response to bacterium	IEA
GO:0043032	Process	Positive regulation of macrophage activation	IBA
GO:0043032	Process	Positive regulation of macrophage activation	IDA	8409400
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IC	12932360
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	ISS	2477488
GO:0050829	Process	Defense response to Gram-negative bacterium	IBA
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	11528597
GO:0050829	Process	Defense response to Gram-negative bacterium	IEA
GO:0050829	Process	Defense response to Gram-negative bacterium	ISS	2402637
GO:0050830	Process	Defense response to Gram-positive bacterium	IBA
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	12932360
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0060265	Process	Positive regulation of respiratory burst involved in inflammatory response	IEA
GO:0060265	Process	Positive regulation of respiratory burst involved in inflammatory response	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070891	Function	Lipoteichoic acid binding	IDA	12594207
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	12594207
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IMP	24120359
GO:0071223	Process	Cellular response to lipoteichoic acid	IDA	12594207
GO:0071723	Function	Lipopeptide binding	IDA	15294986
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IEA

Other IDs

• MIM: 151990
• HGNC: 6517
• e!Ensembl: ENSG00000129988

Protein

• UniProt ID: P18428
• Protein name: Lipopolysaccharide-binding protein (LBP)
• Protein function: Plays a role in the innate immune response. Binds to the lipid A moiety of bacterial lipopolysaccharides (LPS), a glycolipid present in the outer membrane of all Gram-negative bacteria (PubMed:24120359, PubMed:7517398). Acts as an affinity enhan
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01273	LBP_BPI_CETP	38 → 212	LBP / BPI / CETP family, N-terminal domain	Family
  PF02886	LBP_BPI_CETP_C	241 → 478	LBP / BPI / CETP family, C-terminal domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in blood serum (at protein level). {ECO:0000269|PubMed:2402637, ECO:0000269|PubMed:24120359}.
• Sequence:

  MGALARALPSILLALLLTSTPEALGANPGLVARITDKGLQYAAQEGLLALQSELLRITLP
  DFTGDLRIPHVGRGRYEFHSLNIHSCELLHSALRPVPGQGLSLSISDSSIRVQGRWKVRK
  SFFKLQGSFDVSVKGISISVNLLLGSESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNL
  FHNQIESKFQKVLESRICEMIQKSVSSDLQPYLQTLPVTTEIDSFADIDYSLVEAPRATA
  QMLEVMFKGEIFHRNHRSPVTLLAAVMSLPEEHNKMVYFAISDYVFNTASLVYHEEGYLN
  FSITDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDP
  YMEIDAFVLLPSSSKEPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKESKVGLFN
  AELLEALLNYYILNTFYPKFNDKLAEGFPLPLLKRVQLYDLGLQIHKDFLFLGANVQYMR
  V

• Sequence length: 481

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
EXANTHEMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME X	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	16046876, 28849499		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	11283204, 12555245		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	28851981, 31615282		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	37350306	Stimulate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	31560453		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29137477		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	32404914, 34458379	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28444548		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	37438758	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29137477		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	37199526	Stimulate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	37199526	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30991100		★☆☆☆☆ Found in Text Mining only
Brooke-Spiegler syndrome	Brooke-Spiegler Syndrome	BEFREE	31326433		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	10091598, 34722779, 36002595	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28486964, 30219816, 30768357, 31657258		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	32327445	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	22476641		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31269910		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	24785111		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	31780859		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	1339304, 1534386		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21633598, 29189972		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21633598, 32375704	Associate	★☆☆☆☆ Found in Text Mining only
Congenital glucose-galactose malabsorption	Congenital glucose-galactose malabsorption	BEFREE	30256506		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28936621		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	27171210		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	27171210		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	34571843	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	27171210		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary stenosis	Pubtator	32327445	Associate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	30015388		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	17442982, 20865702		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	21334452	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	16183806		★☆☆☆☆ Found in Text Mining only
Dandy-Walker Syndrome	Dandy-Walker Syndrome	BEFREE	28569153		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	29353229		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30098513		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	27838098, 28884590		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	23704966	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27838098, 28884590		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	32327445	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28851981, 34161346	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17466274, 27745826, 28486964, 28851981, 29096623, 31536546		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	35068329	Stimulate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	17902044		★☆☆☆☆ Found in Text Mining only
Dysbiosis	Dysbiosis	Pubtator	26539989	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	32973805	Associate	★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	28135842		★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	27338587	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	30458048		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	18000721, 28216979, 28464257		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30458048		★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	31620075		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31628293		★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	38107520	Stimulate	★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	31482782	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	30118351, 31460790		★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	36002595	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	30219816		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	30219816		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28575205, 29137477, 30015388		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	26799617	Associate	★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	28916545		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	27387474, 31357597		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	24785111		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22640039		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	26725065, 30218108		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	40155834	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	16710089		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30991100		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28107548		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24929142		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30591812		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30098513		★☆☆☆☆ Found in Text Mining only
Metabolic Bone Disorder	Metabolic Bone Disorder	BEFREE	30422989		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	26799617	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28107471, 28850019		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	23349936	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	23349936, 25978344, 30038669, 30219816		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	CTD_human_DG	23349936		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	BEFREE	30098513		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	36462169	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	28262744	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	27718209		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	12521224, 27171210, 31414117		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	32736138	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22640039, 30952727, 31628293		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	18000721, 27404046, 28107471, 28216979, 28464257, 28880885, 30235828, 30458048, 30896956		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	18000721, 28216979		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	21239459, 23349936, 28107471, 28486964, 28487462, 28684860, 29914624, 30038669, 30219816, 30353127, 30458048, 30903427		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	23349936		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	23349936	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	23704966	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity Abdominal	Obesity	Pubtator	23349936	Associate	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	30896956		★☆☆☆☆ Found in Text Mining only
Oligoarticular Juvenile Idiopathic Arthritis	Oligoarticular Arthritis	BEFREE	28916545		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	30144513, 31560453		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30422989		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	16875458	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	31314190	Stimulate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	26539989, 29494603		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	26539989	Inhibit	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	23601005		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	27531006	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	26799617	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28107548		★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	26962819		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34113087	Stimulate	★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	31357597		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	32780727	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28850019, 29246875, 31560453, 31780859		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	35294531	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	29310912		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	33632634	Associate	★☆☆☆☆ Found in Text Mining only
SEBASTIAN SYNDROME	SEBASTIAN SYNDROME	BEFREE	31326433		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	16875458	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	11373419, 12615620, 19707138, 22167001, 28135842, 30479651, 7688151, 8668165		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	CTD_human_DG	22167001		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	29137477, 29245360, 29843666		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	18000721, 28216979, 30458048, 30896956		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24929142		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35299682, 35936362	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	40155834	Stimulate	★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	28851981		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	Pubtator	28851981	Inhibit	★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	31651576		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	16710089		★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	35426199	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	35426199	Stimulate	★☆☆☆☆ Found in Text Mining only
Winter Shortland Temple syndrome	Winter shortland temple syndrome	Pubtator	29367348	Associate	★☆☆☆☆ Found in Text Mining only