Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	4259
Gene name	Microsomal glutathione S-transferase 3
Gene symbol	MGST3
Synonyms (NCBI Gene)	GST-3GST-III
Chromosome	1
Chromosome location	1q24.1
Summary	This gene encodes a member of the MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) protein family. Members of this family are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation.

102 Show/Hide all (102)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029259	hsa-miR-26b-5p	Microarray	19088304
MIRT646093	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT646092	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT646091	hsa-miR-1245a	HITS-CLIP	23824327
MIRT646090	hsa-miR-8079	HITS-CLIP	23824327
MIRT646089	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT646088	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT646087	hsa-miR-4292	HITS-CLIP	23824327
MIRT646086	hsa-miR-6791-5p	HITS-CLIP	23824327
MIRT646085	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT646084	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT646083	hsa-miR-378g	HITS-CLIP	23824327
MIRT646082	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT646081	hsa-miR-4437	HITS-CLIP	23824327
MIRT646080	hsa-miR-1260a	HITS-CLIP	23824327
MIRT646079	hsa-miR-1260b	HITS-CLIP	23824327
MIRT646077	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT646078	hsa-miR-4674	HITS-CLIP	23824327
MIRT732942	hsa-miR-432-5p	Luciferase reporter assayWestern blottingRNA-seqqRT-PCRIn situ hybridization	32158694
MIRT646093	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT646092	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT646091	hsa-miR-1245a	HITS-CLIP	23824327
MIRT646090	hsa-miR-8079	HITS-CLIP	23824327
MIRT646089	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT646088	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT646087	hsa-miR-4292	HITS-CLIP	23824327
MIRT646086	hsa-miR-6791-5p	HITS-CLIP	23824327
MIRT646085	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT646084	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT646083	hsa-miR-378g	HITS-CLIP	23824327
MIRT646082	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT646081	hsa-miR-4437	HITS-CLIP	23824327
MIRT646080	hsa-miR-1260a	HITS-CLIP	23824327
MIRT646079	hsa-miR-1260b	HITS-CLIP	23824327
MIRT646077	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT646078	hsa-miR-4674	HITS-CLIP	23824327
MIRT1147689	hsa-miR-103a	CLIP-seq
MIRT1147690	hsa-miR-107	CLIP-seq
MIRT1147691	hsa-miR-122	CLIP-seq
MIRT1147692	hsa-miR-2467-5p	CLIP-seq
MIRT1147693	hsa-miR-3135b	CLIP-seq
MIRT1147694	hsa-miR-3188	CLIP-seq
MIRT1147695	hsa-miR-3194-3p	CLIP-seq
MIRT1147696	hsa-miR-3545-3p	CLIP-seq
MIRT1147697	hsa-miR-3663-5p	CLIP-seq
MIRT1147698	hsa-miR-3929	CLIP-seq
MIRT1147699	hsa-miR-3942-3p	CLIP-seq
MIRT1147700	hsa-miR-3944-5p	CLIP-seq
MIRT1147701	hsa-miR-3975	CLIP-seq
MIRT1147702	hsa-miR-4302	CLIP-seq
MIRT1147703	hsa-miR-431	CLIP-seq
MIRT1147704	hsa-miR-4419b	CLIP-seq
MIRT1147705	hsa-miR-4478	CLIP-seq
MIRT1147706	hsa-miR-4519	CLIP-seq
MIRT1147707	hsa-miR-4635	CLIP-seq
MIRT1147708	hsa-miR-4755-3p	CLIP-seq
MIRT1147709	hsa-miR-4795-3p	CLIP-seq
MIRT1147710	hsa-miR-485-5p	CLIP-seq
MIRT1147689	hsa-miR-103a	CLIP-seq
MIRT1147690	hsa-miR-107	CLIP-seq
MIRT1147691	hsa-miR-122	CLIP-seq
MIRT2042047	hsa-miR-1273f	CLIP-seq
MIRT2042048	hsa-miR-129-5p	CLIP-seq
MIRT1147693	hsa-miR-3135b	CLIP-seq
MIRT2042049	hsa-miR-3170	CLIP-seq
MIRT1147695	hsa-miR-3194-3p	CLIP-seq
MIRT2042050	hsa-miR-3674	CLIP-seq
MIRT1147700	hsa-miR-3944-5p	CLIP-seq
MIRT1147702	hsa-miR-4302	CLIP-seq
MIRT1147706	hsa-miR-4519	CLIP-seq
MIRT2042051	hsa-miR-4732-5p	CLIP-seq
MIRT2042052	hsa-miR-4775	CLIP-seq
MIRT2042053	hsa-miR-590-3p	CLIP-seq
MIRT1147689	hsa-miR-103a	CLIP-seq
MIRT1147690	hsa-miR-107	CLIP-seq
MIRT2271757	hsa-miR-1184	CLIP-seq
MIRT1147691	hsa-miR-122	CLIP-seq
MIRT1147693	hsa-miR-3135b	CLIP-seq
MIRT2271758	hsa-miR-3680	CLIP-seq
MIRT1147700	hsa-miR-3944-5p	CLIP-seq
MIRT1147702	hsa-miR-4302	CLIP-seq
MIRT2271759	hsa-miR-4418	CLIP-seq
MIRT2271760	hsa-miR-4494	CLIP-seq
MIRT1147706	hsa-miR-4519	CLIP-seq
MIRT2271761	hsa-miR-4714-3p	CLIP-seq
MIRT2271762	hsa-miR-499a-5p	CLIP-seq
MIRT2271763	hsa-miR-509-3-5p	CLIP-seq
MIRT2271764	hsa-miR-509-5p	CLIP-seq
MIRT2271765	hsa-miR-513c	CLIP-seq
MIRT2271766	hsa-miR-514b-5p	CLIP-seq
MIRT1147689	hsa-miR-103a	CLIP-seq
MIRT1147690	hsa-miR-107	CLIP-seq
MIRT1147691	hsa-miR-122	CLIP-seq
MIRT2390867	hsa-miR-224	CLIP-seq
MIRT1147700	hsa-miR-3944-5p	CLIP-seq
MIRT2390868	hsa-miR-4729	CLIP-seq
MIRT2685001	hsa-miR-1245	CLIP-seq
MIRT2685002	hsa-miR-1260	CLIP-seq
MIRT2685003	hsa-miR-1280	CLIP-seq
MIRT2685004	hsa-miR-150	CLIP-seq
MIRT2685005	hsa-miR-3620	CLIP-seq
MIRT2685006	hsa-miR-562	CLIP-seq

29 Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004364	Function	Glutathione transferase activity	IBA
GO:0004364	Function	Glutathione transferase activity	IDA	9278457
GO:0004364	Function	Glutathione transferase activity	IDA	36370807
GO:0004464	Function	Leukotriene-C4 synthase activity	IDA	9278457
GO:0004464	Function	Leukotriene-C4 synthase activity	IEA
GO:0004602	Function	Glutathione peroxidase activity	IBA
GO:0004602	Function	Glutathione peroxidase activity	IDA	9278457
GO:0005515	Function	Protein binding	IPI	25416956, 29568061, 32296183
GO:0005635	Component	Nuclear envelope	IBA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IDA	27184847
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006629	Process	Lipid metabolic process	IDA	9278457
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006691	Process	Leukotriene metabolic process	IEA
GO:0006692	Process	Prostanoid metabolic process	IDA	36370807
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IDA	9278457
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016829	Function	Lyase activity	IEA
GO:0019369	Process	Arachidonate metabolic process	IEA
GO:0019370	Process	Leukotriene biosynthetic process	IDA	9278457
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0098869	Process	Cellular oxidant detoxification	IEA

MIM	HGNC	e!Ensembl
604564	7064	ENSG00000143198

O14880

Protein name

Glutathione S-transferase 3, mitochondrial (GST-3) (EC 2.5.1.-) (Glutathione peroxidase MGST3) (EC 1.11.1.-) (LTC4 synthase MGST3) (EC 4.4.1.20)

Protein function

Displays both glutathione S-transferase and glutathione peroxidase activities toward oxyeicosanoids, as part of cellular detoxification as well as synthesis of bioactive metabolites (PubMed:36370807, PubMed:9278457). Catalyzes conjugate addition

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01124	MAPEG	11 → 134	MAPEG family	Family

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in heart, skeletal muscle, and adrenal cortex. Also found in brain, placenta, liver, kidney, pancreas, thyroid, testis and ovary. Almost absent in lung, thymus and peripheral blood leukocytes. Expressed in mast

Sequence

MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRA
HQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSI
ALLGLVGTTVCSAFQHLGWVKSGLGSGPKCCH

Sequence length

152

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Glutathione metabolism	Glutathione conjugation
Metabolism of xenobiotics by cytochrome P450	Aflatoxin activation and detoxification
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis - DNA adducts
Chemical carcinogenesis - receptor activation
Chemical carcinogenesis - reactive oxygen species
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Malignant lymphoma, large B-cell, diffuse	association	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary disease, chronic obstructive, susceptibility to	association; protective	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	association	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (8)
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	30777612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29333087, 35906899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	29333087	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12898215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36168622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	25280473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	32496000	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29802697	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
MGST1	[]	12	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation","Aflatoxin activation and detoxification"]	[]
MGST2	[]	12	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation","Aflatoxin activation and detoxification"]	[]
GSTA5	[]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	[]
GSTA3	[]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	[]
GSTA4	[]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	[]

MGST3 (microsomal glutathione S-transferase 3)

Save This Analysis