Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	4258
Gene name	Microsomal glutathione S-transferase 2
Gene symbol	MGST2
Synonyms (NCBI Gene)	GST2MGST-II
Chromosome	4
Chromosome location	4q31.1
Summary	The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, several of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. This gene en

24 Show/Hide all (24)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020512	hsa-miR-155-5p	Proteomics	18668040
MIRT028440	hsa-miR-30a-5p	Proteomics	18668040
MIRT043852	hsa-miR-340-3p	CLASH	23622248
MIRT1147679	hsa-miR-1292	CLIP-seq
MIRT1147680	hsa-miR-205	CLIP-seq
MIRT1147681	hsa-miR-2276	CLIP-seq
MIRT1147682	hsa-miR-4471	CLIP-seq
MIRT1147683	hsa-miR-4724-3p	CLIP-seq
MIRT1147684	hsa-miR-4772-3p	CLIP-seq
MIRT1147685	hsa-miR-541	CLIP-seq
MIRT1147686	hsa-miR-544	CLIP-seq
MIRT1147687	hsa-miR-556-3p	CLIP-seq
MIRT1147688	hsa-miR-654-5p	CLIP-seq
MIRT2271751	hsa-miR-1253	CLIP-seq
MIRT1147679	hsa-miR-1292	CLIP-seq
MIRT1147681	hsa-miR-2276	CLIP-seq
MIRT2271752	hsa-miR-3124-3p	CLIP-seq
MIRT2271753	hsa-miR-3692	CLIP-seq
MIRT2271754	hsa-miR-4434	CLIP-seq
MIRT1147682	hsa-miR-4471	CLIP-seq
MIRT2271755	hsa-miR-4516	CLIP-seq
MIRT1147684	hsa-miR-4772-3p	CLIP-seq
MIRT2271756	hsa-miR-4778-3p	CLIP-seq
MIRT1147686	hsa-miR-544	CLIP-seq

38 Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004364	Function	Glutathione transferase activity	IBA
GO:0004364	Function	Glutathione transferase activity	IDA	8703034, 23409838
GO:0004364	Function	Glutathione transferase activity	IEA
GO:0004464	Function	Leukotriene-C4 synthase activity	IBA
GO:0004464	Function	Leukotriene-C4 synthase activity	IDA	8703034, 9092565, 23409838
GO:0004464	Function	Leukotriene-C4 synthase activity	IEA
GO:0004602	Function	Glutathione peroxidase activity	IBA
GO:0004602	Function	Glutathione peroxidase activity	IDA	9278457, 23409838
GO:0004602	Function	Glutathione peroxidase activity	IEA
GO:0005515	Function	Protein binding	IPI	25910212, 32296183
GO:0005635	Component	Nuclear envelope	IBA
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	IDA	9092565
GO:0006629	Process	Lipid metabolic process	IDA	9278457
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006691	Process	Leukotriene metabolic process	IEA
GO:0006750	Process	Glutathione biosynthetic process	IDA	8703034
GO:0008047	Function	Enzyme activator activity	IEA
GO:0016020	Component	Membrane	IDA	9278457
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016829	Function	Lyase activity	IEA
GO:0019370	Process	Leukotriene biosynthetic process	IBA
GO:0019370	Process	Leukotriene biosynthetic process	IDA	8703034, 9092565, 23409838
GO:0019370	Process	Leukotriene biosynthetic process	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0042802	Function	Identical protein binding	IDA	26066610
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA	8703034
GO:0043295	Function	Glutathione binding	IDA	26066610
GO:0046394	Process	Carboxylic acid biosynthetic process	IEA
GO:0046466	Process	Membrane lipid catabolic process	IDA	23409838
GO:0050729	Process	Positive regulation of inflammatory response	NAS	23409838
GO:0098869	Process	Cellular oxidant detoxification	IEA

MIM	HGNC	e!Ensembl
601733	7063	ENSG00000085871

Q99735

Protein name

Microsomal glutathione S-transferase 2 (Microsomal GST-2) (EC 2.5.1.18) (Glutathione peroxidase MGST2) (EC 1.11.1.-) (Leukotriene C4 synthase MGST2) (EC 4.4.1.20) (Microsomal glutathione S-transferase II) (Microsomal GST-II)

Protein function

Catalyzes several different glutathione-dependent reactions (PubMed:23409838, PubMed:26066610, PubMed:26656251, PubMed:8703034, PubMed:9278457). Catalyzes the glutathione-dependent reduction of lipid hydroperoxides, such as 5-HPETE (PubMed:23409

PDB

6SSR , 6SSS , 6SSU , 6SSW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01124	MAPEG	8 → 124	MAPEG family	Family

Tissue specificity

TISSUE SPECIFICITY: Liver, spleen, skeletal muscle, heart, adrenals, pancreas, prostate, testis, fetal liver, and fetal spleen. Very low expression in lung, brain, placenta and bone marrow (PubMed:8703034). Abundantly expressed in human umbilical vein end

Sequence

MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVFRAQQNCVEFY
PIFIITLWMAGWYFNQVFATCLGLVYIYGRHLYFWGYSEAAKKRITGFRLSLGILALLTL
LGALGIANSFLDEYLDLNIAKKLRRQF

Sequence length

147

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Glutathione metabolism	Glutathione conjugation
Metabolism of xenobiotics by cytochrome P450	Aflatoxin activation and detoxification
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis - DNA adducts
Chemical carcinogenesis - receptor activation
Chemical carcinogenesis - reactive oxygen species
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	37359372	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VESICOURETERAL REFLUX	—	GWAS catalog	33597122	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Crohn Disease	Crohn disease	Pubtator	35872023	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10666225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	16773312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	16498398, 16773312		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
MGST1	[]	12	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation","Aflatoxin activation and detoxification"]	[]
MGST3	[]	12	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation","Aflatoxin activation and detoxification"]	[]
GSTA5	[]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	[]
GSTA3	[]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	[]
GSTA4	[]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	[]

MGST2 (microsomal glutathione S-transferase 2)

Save This Analysis