Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	2941
Gene name	Glutathione S-transferase alpha 4
Gene symbol	GSTA4
Synonyms (NCBI Gene)	GSTA4-4GTA4
Chromosome	6
Chromosome location	6p12.2
Summary	Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, e

127 Show/Hide all (127)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045335	hsa-miR-185-5p	CLASH	23622248
MIRT1036474	hsa-miR-1243	CLIP-seq
MIRT1036475	hsa-miR-342-3p	CLIP-seq
MIRT1036476	hsa-miR-3613-3p	CLIP-seq
MIRT1036477	hsa-miR-3654	CLIP-seq
MIRT1036478	hsa-miR-377	CLIP-seq
MIRT1036479	hsa-miR-4638-3p	CLIP-seq
MIRT1036480	hsa-miR-4643	CLIP-seq
MIRT1036481	hsa-miR-4699-3p	CLIP-seq
MIRT1036482	hsa-miR-4717-3p	CLIP-seq
MIRT1036483	hsa-miR-4764-5p	CLIP-seq
MIRT1036484	hsa-miR-4802-3p	CLIP-seq
MIRT1036485	hsa-miR-490-5p	CLIP-seq
MIRT1036486	hsa-miR-668	CLIP-seq
MIRT1036487	hsa-miR-944	CLIP-seq
MIRT1549407	hsa-miR-28-3p	CLIP-seq
MIRT1549408	hsa-miR-3150b-3p	CLIP-seq
MIRT1549409	hsa-miR-4257	CLIP-seq
MIRT1549410	hsa-miR-4305	CLIP-seq
MIRT1036481	hsa-miR-4699-3p	CLIP-seq
MIRT1549411	hsa-miR-4729	CLIP-seq
MIRT1549412	hsa-miR-4784	CLIP-seq
MIRT1549408	hsa-miR-3150b-3p	CLIP-seq
MIRT2239916	hsa-miR-33a	CLIP-seq
MIRT2239917	hsa-miR-33b	CLIP-seq
MIRT1549409	hsa-miR-4257	CLIP-seq
MIRT1549412	hsa-miR-4784	CLIP-seq
MIRT2239918	hsa-miR-556-3p	CLIP-seq
MIRT2239919	hsa-miR-664	CLIP-seq
MIRT2388798	hsa-miR-3117-3p	CLIP-seq
MIRT2388799	hsa-miR-374c	CLIP-seq
MIRT2388800	hsa-miR-376c	CLIP-seq
MIRT2388801	hsa-miR-655	CLIP-seq
MIRT2388802	hsa-miR-711	CLIP-seq
MIRT2543452	hsa-miR-1183	CLIP-seq
MIRT2543453	hsa-miR-1251	CLIP-seq
MIRT2543454	hsa-miR-200b	CLIP-seq
MIRT2543455	hsa-miR-200c	CLIP-seq
MIRT2543456	hsa-miR-208a	CLIP-seq
MIRT2543457	hsa-miR-208b	CLIP-seq
MIRT2543458	hsa-miR-2682	CLIP-seq
MIRT1549407	hsa-miR-28-3p	CLIP-seq
MIRT2543459	hsa-miR-29a	CLIP-seq
MIRT2543460	hsa-miR-29b	CLIP-seq
MIRT2543461	hsa-miR-29c	CLIP-seq
MIRT2388798	hsa-miR-3117-3p	CLIP-seq
MIRT1549408	hsa-miR-3150b-3p	CLIP-seq
MIRT2239916	hsa-miR-33a	CLIP-seq
MIRT2239917	hsa-miR-33b	CLIP-seq
MIRT2543462	hsa-miR-3617	CLIP-seq
MIRT2543463	hsa-miR-3667-5p	CLIP-seq
MIRT2543464	hsa-miR-3675-3p	CLIP-seq
MIRT2388799	hsa-miR-374c	CLIP-seq
MIRT2388800	hsa-miR-376c	CLIP-seq
MIRT2543465	hsa-miR-3914	CLIP-seq
MIRT1549409	hsa-miR-4257	CLIP-seq
MIRT2543466	hsa-miR-429	CLIP-seq
MIRT1549410	hsa-miR-4305	CLIP-seq
MIRT2543467	hsa-miR-4423-3p	CLIP-seq
MIRT2543468	hsa-miR-4463	CLIP-seq
MIRT2543469	hsa-miR-4477a	CLIP-seq
MIRT2543470	hsa-miR-4487	CLIP-seq
MIRT2543471	hsa-miR-449c	CLIP-seq
MIRT2543472	hsa-miR-450b-3p	CLIP-seq
MIRT1036481	hsa-miR-4699-3p	CLIP-seq
MIRT2543473	hsa-miR-4713-3p	CLIP-seq
MIRT1549411	hsa-miR-4729	CLIP-seq
MIRT1549412	hsa-miR-4784	CLIP-seq
MIRT2543474	hsa-miR-499-5p	CLIP-seq
MIRT2543475	hsa-miR-548c-3p	CLIP-seq
MIRT2239918	hsa-miR-556-3p	CLIP-seq
MIRT2543476	hsa-miR-603	CLIP-seq
MIRT2543477	hsa-miR-638	CLIP-seq
MIRT2543478	hsa-miR-641	CLIP-seq
MIRT2543479	hsa-miR-642b	CLIP-seq
MIRT2388801	hsa-miR-655	CLIP-seq
MIRT2239919	hsa-miR-664	CLIP-seq
MIRT1036486	hsa-miR-668	CLIP-seq
MIRT2388802	hsa-miR-711	CLIP-seq
MIRT2543480	hsa-miR-767-5p	CLIP-seq
MIRT2543481	hsa-miR-769-3p	CLIP-seq
MIRT2543482	hsa-miR-885-5p	CLIP-seq
MIRT2543483	hsa-miR-940	CLIP-seq
MIRT2543484	hsa-miR-943	CLIP-seq
MIRT2543452	hsa-miR-1183	CLIP-seq
MIRT2543453	hsa-miR-1251	CLIP-seq
MIRT2543454	hsa-miR-200b	CLIP-seq
MIRT2543455	hsa-miR-200c	CLIP-seq
MIRT2543456	hsa-miR-208a	CLIP-seq
MIRT2543457	hsa-miR-208b	CLIP-seq
MIRT1549407	hsa-miR-28-3p	CLIP-seq
MIRT2543459	hsa-miR-29a	CLIP-seq
MIRT2543460	hsa-miR-29b	CLIP-seq
MIRT2543461	hsa-miR-29c	CLIP-seq
MIRT2388798	hsa-miR-3117-3p	CLIP-seq
MIRT1549408	hsa-miR-3150b-3p	CLIP-seq
MIRT2239916	hsa-miR-33a	CLIP-seq
MIRT2239917	hsa-miR-33b	CLIP-seq
MIRT2543462	hsa-miR-3617	CLIP-seq
MIRT2543463	hsa-miR-3667-5p	CLIP-seq
MIRT2543464	hsa-miR-3675-3p	CLIP-seq
MIRT2388799	hsa-miR-374c	CLIP-seq
MIRT2388800	hsa-miR-376c	CLIP-seq
MIRT2543465	hsa-miR-3914	CLIP-seq
MIRT1549409	hsa-miR-4257	CLIP-seq
MIRT2543466	hsa-miR-429	CLIP-seq
MIRT1549410	hsa-miR-4305	CLIP-seq
MIRT2543469	hsa-miR-4477a	CLIP-seq
MIRT2543470	hsa-miR-4487	CLIP-seq
MIRT2543472	hsa-miR-450b-3p	CLIP-seq
MIRT1036481	hsa-miR-4699-3p	CLIP-seq
MIRT2543473	hsa-miR-4713-3p	CLIP-seq
MIRT1549411	hsa-miR-4729	CLIP-seq
MIRT1549412	hsa-miR-4784	CLIP-seq
MIRT2543474	hsa-miR-499-5p	CLIP-seq
MIRT2239918	hsa-miR-556-3p	CLIP-seq
MIRT2543476	hsa-miR-603	CLIP-seq
MIRT2543477	hsa-miR-638	CLIP-seq
MIRT2543478	hsa-miR-641	CLIP-seq
MIRT2543479	hsa-miR-642b	CLIP-seq
MIRT2388801	hsa-miR-655	CLIP-seq
MIRT2239919	hsa-miR-664	CLIP-seq
MIRT2388802	hsa-miR-711	CLIP-seq
MIRT2543480	hsa-miR-767-5p	CLIP-seq
MIRT2543481	hsa-miR-769-3p	CLIP-seq
MIRT2543482	hsa-miR-885-5p	CLIP-seq
MIRT2543484	hsa-miR-943	CLIP-seq

15 Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004364	Function	Glutathione transferase activity	IBA
GO:0004364	Function	Glutathione transferase activity	IDA	10329152, 11851347
GO:0004364	Function	Glutathione transferase activity	IEA
GO:0004364	Function	Glutathione transferase activity	TAS	9480897
GO:0005515	Function	Protein binding	IPI	25416956, 25910212, 28514442, 31515488, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	15100242
GO:0005829	Component	Cytosol	TAS
GO:0006749	Process	Glutathione metabolic process	IBA
GO:0006749	Process	Glutathione metabolic process	IDA	10329152
GO:0006805	Process	Xenobiotic metabolic process	IBA
GO:0006805	Process	Xenobiotic metabolic process	IDA	10329152
GO:0016740	Function	Transferase activity	IEA
GO:0042802	Function	Identical protein binding	IPI	16189514, 25416956, 32296183
GO:0042803	Function	Protein homodimerization activity	IPI	10329152

MIM	HGNC	e!Ensembl
605450	4629	ENSG00000170899

O15217

Protein name

Glutathione S-transferase A4 (EC 2.5.1.18) (GST class-alpha member 4) (Glutathione S-transferase A4-4)

Protein function

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. This isozyme has a high catalytic efficiency with 4-hydroxyalkenals such as 4-hydroxynonenal (4-HNE). {ECO:0000269|PubMed:10329152, ECO:00

PDB

1GUL , 1GUM , 3IK7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02798	GST_N	5 → 77	Glutathione S-transferase, N-terminal domain	Domain
PF14497	GST_C_3	100 → 201	Glutathione S-transferase, C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed at a high level in brain, placenta, and skeletal muscle and much lower in lung and liver.

Sequence

MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEI
DGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKE
VVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPF
LQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP

Sequence length

222

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Glutathione metabolism	Glutathione conjugation
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis - DNA adducts
Chemical carcinogenesis - receptor activation
Chemical carcinogenesis - reactive oxygen species
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARTERIOSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	15064094, 20177342	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	GWAS catalog	23962720	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	16510128	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (36)
Adenoma	Adenoma	BEFREE	27065323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	CTD_human_DG	15064094, 20177342		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	18485437, 9461507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	36945018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30537571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16360395, 27065323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18767114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	9461507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	29180269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	25798860	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	27065323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	29941222	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27065323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	27463229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	20097730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	20097730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	20150287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	23962720	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	29180269	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12907637, 28337261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	26518673	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	18767114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18767114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	36162957	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	35546551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20966433, 28337261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	27998724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	20150287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	16054170		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	16054170, 28672859, 29681884		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	CTD_human_DG	16510128		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	9461507	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin carcinoma	Skin Carcinoma	BEFREE	20966433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	20966433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18767114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21751261		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
GSTM1	[]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	2	["Disgenet (Parkinson disease)","CTD (Parkinson disease)"]
GSTA5	[]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	0	[]
GSTA3	[]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	0	[]
GSTM2	[]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	0	[]
GSTM3	[]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	0	[]

GSTA4 (glutathione S-transferase alpha 4)

Save This Analysis