Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	4133
Gene name	Microtubule associated protein 2
Gene symbol	MAP2
Synonyms (NCBI Gene)	MAP-2MAP2AMAP2BMAP2C
Chromosome	2
Chromosome location	2q34
Summary	This gene encodes a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The products of similar genes in rat and mou

172 Show/Hide all (172)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019140	hsa-miR-335-5p	Microarray	18185580
MIRT440291	hsa-miR-382-3p	HITS-CLIP	24374217
MIRT440291	hsa-miR-382-3p	HITS-CLIP	24374217
MIRT736775	hsa-miR-26a-5p	Western blottingImmunofluorescenceqRT-PCR	32290095
MIRT1127853	hsa-miR-1290	CLIP-seq
MIRT1127854	hsa-miR-188-5p	CLIP-seq
MIRT1127855	hsa-miR-3121-5p	CLIP-seq
MIRT1127856	hsa-miR-3125	CLIP-seq
MIRT1127857	hsa-miR-3129-3p	CLIP-seq
MIRT1127858	hsa-miR-3167	CLIP-seq
MIRT1127859	hsa-miR-3168	CLIP-seq
MIRT1127860	hsa-miR-324-5p	CLIP-seq
MIRT1127861	hsa-miR-3672	CLIP-seq
MIRT1127862	hsa-miR-3916	CLIP-seq
MIRT1127863	hsa-miR-3922-5p	CLIP-seq
MIRT1127864	hsa-miR-3928	CLIP-seq
MIRT1127865	hsa-miR-4453	CLIP-seq
MIRT1127866	hsa-miR-4461	CLIP-seq
MIRT1127867	hsa-miR-4468	CLIP-seq
MIRT1127868	hsa-miR-4538	CLIP-seq
MIRT1127869	hsa-miR-4699-5p	CLIP-seq
MIRT1127870	hsa-miR-4711-3p	CLIP-seq
MIRT1127871	hsa-miR-4738-3p	CLIP-seq
MIRT1127872	hsa-miR-4780	CLIP-seq
MIRT1127873	hsa-miR-4786-5p	CLIP-seq
MIRT1127874	hsa-miR-593	CLIP-seq
MIRT1127875	hsa-miR-623	CLIP-seq
MIRT1127876	hsa-miR-646	CLIP-seq
MIRT1127877	hsa-miR-758	CLIP-seq
MIRT1127878	hsa-miR-769-5p	CLIP-seq
MIRT1127879	hsa-miR-876-5p	CLIP-seq
MIRT1127880	hsa-miR-1255a	CLIP-seq
MIRT1127881	hsa-miR-1255b	CLIP-seq
MIRT1127882	hsa-miR-1297	CLIP-seq
MIRT1127883	hsa-miR-1298	CLIP-seq
MIRT1127884	hsa-miR-139-5p	CLIP-seq
MIRT1127885	hsa-miR-2110	CLIP-seq
MIRT1127886	hsa-miR-214	CLIP-seq
MIRT1127887	hsa-miR-26a	CLIP-seq
MIRT1127888	hsa-miR-26b	CLIP-seq
MIRT1127889	hsa-miR-3150a-3p	CLIP-seq
MIRT1127890	hsa-miR-3619-5p	CLIP-seq
MIRT1127891	hsa-miR-369-3p	CLIP-seq
MIRT1127892	hsa-miR-374a	CLIP-seq
MIRT1127893	hsa-miR-374b	CLIP-seq
MIRT1127894	hsa-miR-384	CLIP-seq
MIRT1127895	hsa-miR-3915	CLIP-seq
MIRT1127864	hsa-miR-3928	CLIP-seq
MIRT1127896	hsa-miR-4260	CLIP-seq
MIRT1127897	hsa-miR-4272	CLIP-seq
MIRT1127898	hsa-miR-4291	CLIP-seq
MIRT1127899	hsa-miR-4450	CLIP-seq
MIRT1127900	hsa-miR-4465	CLIP-seq
MIRT1127869	hsa-miR-4699-5p	CLIP-seq
MIRT1127901	hsa-miR-4719	CLIP-seq
MIRT1127902	hsa-miR-4720-5p	CLIP-seq
MIRT1127871	hsa-miR-4738-3p	CLIP-seq
MIRT1127903	hsa-miR-4799-3p	CLIP-seq
MIRT1127904	hsa-miR-512-5p	CLIP-seq
MIRT1127905	hsa-miR-520a-5p	CLIP-seq
MIRT1127906	hsa-miR-525-5p	CLIP-seq
MIRT1127907	hsa-miR-582-5p	CLIP-seq
MIRT1127908	hsa-miR-605	CLIP-seq
MIRT1127909	hsa-miR-761	CLIP-seq
MIRT1127910	hsa-miR-922	CLIP-seq
MIRT2036287	hsa-miR-1284	CLIP-seq
MIRT2036288	hsa-miR-200b	CLIP-seq
MIRT2036289	hsa-miR-200c	CLIP-seq
MIRT2036290	hsa-miR-3120-3p	CLIP-seq
MIRT2036291	hsa-miR-3614-3p	CLIP-seq
MIRT1127891	hsa-miR-369-3p	CLIP-seq
MIRT2036292	hsa-miR-429	CLIP-seq
MIRT2036293	hsa-miR-450b-5p	CLIP-seq
MIRT2036294	hsa-miR-511	CLIP-seq
MIRT2036295	hsa-miR-518a-5p	CLIP-seq
MIRT2036296	hsa-miR-527	CLIP-seq
MIRT2442341	hsa-miR-4680-5p	CLIP-seq
MIRT1127871	hsa-miR-4738-3p	CLIP-seq
MIRT2453653	hsa-miR-544	CLIP-seq
MIRT2453654	hsa-miR-579	CLIP-seq
MIRT2453655	hsa-miR-664	CLIP-seq
MIRT2465605	hsa-miR-4659a-5p	CLIP-seq
MIRT2465606	hsa-miR-4659b-5p	CLIP-seq
MIRT2465607	hsa-miR-4776-3p	CLIP-seq
MIRT2453653	hsa-miR-544	CLIP-seq
MIRT2453654	hsa-miR-579	CLIP-seq
MIRT2453655	hsa-miR-664	CLIP-seq
MIRT2566205	hsa-miR-105	CLIP-seq
MIRT2566206	hsa-miR-106a	CLIP-seq
MIRT2566207	hsa-miR-106b	CLIP-seq
MIRT2566208	hsa-miR-1282	CLIP-seq
MIRT1127883	hsa-miR-1298	CLIP-seq
MIRT2566209	hsa-miR-1324	CLIP-seq
MIRT2566210	hsa-miR-140-3p	CLIP-seq
MIRT2566211	hsa-miR-17	CLIP-seq
MIRT2566212	hsa-miR-208a	CLIP-seq
MIRT2566213	hsa-miR-208b	CLIP-seq
MIRT2566214	hsa-miR-20a	CLIP-seq
MIRT2566215	hsa-miR-20b	CLIP-seq
MIRT2566216	hsa-miR-216b	CLIP-seq
MIRT2566217	hsa-miR-2467-3p	CLIP-seq
MIRT2566218	hsa-miR-299-5p	CLIP-seq
MIRT2566219	hsa-miR-3074-5p	CLIP-seq
MIRT2566220	hsa-miR-3152-5p	CLIP-seq
MIRT2566221	hsa-miR-3158-5p	CLIP-seq
MIRT2566222	hsa-miR-3163	CLIP-seq
MIRT2566223	hsa-miR-329	CLIP-seq
MIRT2566224	hsa-miR-3617	CLIP-seq
MIRT2566225	hsa-miR-362-3p	CLIP-seq
MIRT2566226	hsa-miR-3647-3p	CLIP-seq
MIRT2566227	hsa-miR-3657	CLIP-seq
MIRT2566228	hsa-miR-3658	CLIP-seq
MIRT2566229	hsa-miR-3678-3p	CLIP-seq
MIRT1127894	hsa-miR-384	CLIP-seq
MIRT2566230	hsa-miR-3941	CLIP-seq
MIRT2566231	hsa-miR-412	CLIP-seq
MIRT2566232	hsa-miR-4251	CLIP-seq
MIRT2566233	hsa-miR-4286	CLIP-seq
MIRT2566234	hsa-miR-4303	CLIP-seq
MIRT2566235	hsa-miR-4325	CLIP-seq
MIRT2566236	hsa-miR-4481	CLIP-seq
MIRT2036293	hsa-miR-450b-5p	CLIP-seq
MIRT2566237	hsa-miR-4668-3p	CLIP-seq
MIRT2566238	hsa-miR-4669	CLIP-seq
MIRT2566239	hsa-miR-4682	CLIP-seq
MIRT1127869	hsa-miR-4699-5p	CLIP-seq
MIRT2566240	hsa-miR-4711-5p	CLIP-seq
MIRT2566241	hsa-miR-4745-5p	CLIP-seq
MIRT2566242	hsa-miR-4758-5p	CLIP-seq
MIRT2566243	hsa-miR-4762-3p	CLIP-seq
MIRT2566244	hsa-miR-4774-3p	CLIP-seq
MIRT1127873	hsa-miR-4786-5p	CLIP-seq
MIRT2566245	hsa-miR-499-5p	CLIP-seq
MIRT2566246	hsa-miR-519a	CLIP-seq
MIRT2566247	hsa-miR-519b-3p	CLIP-seq
MIRT2566248	hsa-miR-519c-3p	CLIP-seq
MIRT2566249	hsa-miR-519d	CLIP-seq
MIRT2453653	hsa-miR-544	CLIP-seq
MIRT2566250	hsa-miR-548ae	CLIP-seq
MIRT2566251	hsa-miR-548aj	CLIP-seq
MIRT2566252	hsa-miR-548am	CLIP-seq
MIRT2566253	hsa-miR-548c-3p	CLIP-seq
MIRT2566254	hsa-miR-548x	CLIP-seq
MIRT2566255	hsa-miR-576-5p	CLIP-seq
MIRT2453654	hsa-miR-579	CLIP-seq
MIRT2566256	hsa-miR-580	CLIP-seq
MIRT2566257	hsa-miR-603	CLIP-seq
MIRT2566258	hsa-miR-641	CLIP-seq
MIRT2453655	hsa-miR-664	CLIP-seq
MIRT1127878	hsa-miR-769-5p	CLIP-seq
MIRT2566259	hsa-miR-891b	CLIP-seq
MIRT2566260	hsa-miR-924	CLIP-seq
MIRT2566261	hsa-miR-93	CLIP-seq
MIRT2566206	hsa-miR-106a	CLIP-seq
MIRT2566207	hsa-miR-106b	CLIP-seq
MIRT2566209	hsa-miR-1324	CLIP-seq
MIRT2566211	hsa-miR-17	CLIP-seq
MIRT2566214	hsa-miR-20a	CLIP-seq
MIRT2566215	hsa-miR-20b	CLIP-seq
MIRT2566219	hsa-miR-3074-5p	CLIP-seq
MIRT2566226	hsa-miR-3647-3p	CLIP-seq
MIRT2566234	hsa-miR-4303	CLIP-seq
MIRT2566235	hsa-miR-4325	CLIP-seq
MIRT2566239	hsa-miR-4682	CLIP-seq
MIRT2566240	hsa-miR-4711-5p	CLIP-seq
MIRT2566243	hsa-miR-4762-3p	CLIP-seq
MIRT2566246	hsa-miR-519a	CLIP-seq
MIRT2566247	hsa-miR-519b-3p	CLIP-seq
MIRT2566248	hsa-miR-519c-3p	CLIP-seq
MIRT2566249	hsa-miR-519d	CLIP-seq
MIRT2566255	hsa-miR-576-5p	CLIP-seq
MIRT2566261	hsa-miR-93	CLIP-seq

Transcription factor	Regulation	Reference
HES1	Repression	19880519

52 Show/Hide all (52)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IBA
GO:0000226	Process	Microtubule cytoskeleton organization	ISS
GO:0002162	Function	Dystroglycan binding	IPI	18341635
GO:0005198	Function	Structural molecule activity	NAS	9588626
GO:0005515	Function	Protein binding	IPI	20195357, 32814053
GO:0005516	Function	Calmodulin binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	ISS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0005875	Component	Microtubule associated complex	TAS	9588626
GO:0005886	Component	Plasma membrane	IDA
GO:0005929	Component	Cilium	IDA
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0008017	Function	Microtubule binding	TAS	26609151
GO:0015631	Function	Tubulin binding	IEA
GO:0016358	Process	Dendrite development	TAS	26609151
GO:0021954	Process	Central nervous system neuron development	IEP	20846339
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0030517	Process	Negative regulation of axon extension	ISS
GO:0031113	Process	Regulation of microtubule polymerization	TAS	10640627
GO:0031115	Process	Negative regulation of microtubule polymerization	ISS
GO:0031175	Process	Neuron projection development	IBA
GO:0031175	Process	Neuron projection development	IEP	20846339
GO:0032839	Component	Dendrite cytoplasm	ISS
GO:0032880	Process	Regulation of protein localization	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0043005	Component	Neuron projection	ISS
GO:0043025	Component	Neuronal cell body	ISS
GO:0043194	Component	Axon initial segment	ISS
GO:0043198	Component	Dendritic shaft	ISS
GO:0043203	Component	Axon hillock	ISS
GO:0044294	Component	Dendritic growth cone	ISS
GO:0044304	Component	Main axon	ISS
GO:0044307	Component	Dendritic branch	ISS
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0048813	Process	Dendrite morphogenesis	IEP	20846339
GO:0097441	Component	Basal dendrite	ISS
GO:0150001	Component	Primary dendrite	ISS
GO:0150002	Component	Distal dendrite	ISS
GO:0150014	Component	Apical distal dendrite	ISS
GO:1901953	Process	Positive regulation of anterograde dense core granule transport	ISS
GO:1902513	Process	Regulation of organelle transport along microtubule	ISS
GO:1902737	Component	Dendritic filopodium	ISS
GO:1903744	Process	Positive regulation of anterograde synaptic vesicle transport	ISS
GO:1990635	Component	Proximal dendrite	ISS
GO:1990769	Component	Proximal neuron projection	ISS

MIM	HGNC	e!Ensembl
157130	6839	ENSG00000078018

P11137

Protein name

Microtubule-associated protein 2 (MAP-2)

Protein function

The exact function of MAP2 is unknown but MAPs may stabilize the microtubules against depolymerization. They also seem to have a stiffening effect on microtubules.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00418	Tubulin-binding	1723 → 1754	Tau and MAP protein, tubulin-binding repeat	Family
PF00418	Tubulin-binding	1692 → 1722	Tau and MAP protein, tubulin-binding repeat	Family
PF00418	Tubulin-binding	1661 → 1691	Tau and MAP protein, tubulin-binding repeat	Family
PF08377	MAP2_projctn	377 → 1505	MAP2/Tau projection domain	Family

Sequence

MADERKDEAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGE
HGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQT
AALPLAAEETANLPPSPPPSPASEQTVTVEEDLLTASKMEFHDQQELTPSTAEPSDQKEK
ESEKQSKPGEDLKHAALVSQPETTKTYPDKKDMQGTEEEKAPLALFGHTLVASLEDMKQK
TEPSLVVPGIDLPKEPPTPKEQKDWFIEMPTEAKKDEWGLVAPISPGPLTPMREKDVFDD
IPKWEGKQFDSPMPSPFQGGSFTLPLDVMKNEIVTETSPFAPAFLQPDDKKSLQQTSGPA
TAKDSFKIEEPHEAKPDKMAEAPPSEAMTLPKDAHIPVVEEHVMGKVLEEEKEAINQETV
QQRDTFTPSGQEPILTEKETELKLEEKTTISDKEAVPKESKPPKPADEEIGIIQTSTEHT
FSEQKDQEPTTDMLKQDSFPVSLEQAVTDSAMTSKTLEKAMTEPSALIEKSSIQELFEMR
VDDKDKIEGVGAATSAELDMPFYEDKSGMSKYFETSALKEEATKSIEPGSDYYELSDTRE
SVHESIDTMSPMHKNGDKEFQTGKESQPSPPAQEAGYSTLAQSYPSDLPEEPSSPQERMF
TIDPKVYGEKRDLHSKNKDDLTLSRSLGLGGRSAIEQRSMSINLPMSCLDSIALGFNFGR
GHDLSPLASDILTNTSGSMDEGDDYLPATTPALEKAPCFPVESKEEEQIEKVKATGEEST
QAEISCESPFLAKDFYKNGTVMAPDLPEMLDLAGTRSRLASVSADAEVARRKSVPSETVV
EDSRTGLPPVTDENHVIVKTDSQLEDLGYCVFNKYTVPLPSPVQDSENLSGESGTFYEGT
DDKVRRDLATDLSLIEVKLAAAGRVKDEFSVDKEASAHISGDKSGLSKEFDQEKKANDRL
DTVLEKSEEHADSKEHAKKTEEAGDEIETFGLGVTYEQALAKDLSIPTDASSEKAEKGLS
SVPEIAEVEPSKKVEQGLDFAVQGQLDVKISDFGQMASGLNIDDRRATELKLEATQDMTP
SSKAPQEADAFMGVESGHMKEGTKVSETEVKEKVAKPDLVHQEAVDKEESYESSGEHESL
TMESLKADEGKKETSPESSLIQDEIAVKLSVEIPCPPAVSEADLATDERADVQMEFIQGP
KEESKETPDISITPSDVAEPLHETIVSEPAEIQSEEEEIEAQGEYDKLLFRSDTLQITDL
GVSGAREEFVETCPSEHKGVIESVVTIEDDFITVVQTTTDEGESGSHSVRFAALEQPEVE
RRPSPHDEEEFEVEEAAEAQAEPKDGSPEAPASPEREEVALSEYKTETYDDYKDETTIDD
SIMDADSLWVDTQDDDRSIMTEQLETIPKEEKAEKEARRSSLEKHRKEKPFKTGRGRIST
PERKVAKKEPSTVSRDEVRRKKAVYKKAELAKKTEVQAHSPSRKFILKPAIKYTRPTHLS
CVKRKTTAAGGESALAPSVFKQAKDKVSDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDE
NSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTP
SYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGST
DNIKYQPKGGQVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKV
GSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSS
GSINLLESPQLATLAEDVTAALAKQGL

Sequence length

1827

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (17)
ANXIETY DISORDER	—	GWAS catalog	37945807	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, JUVENILE	—	CTD	19565504	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	31043756	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	39046104	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EYE DISEASE	—	GWAS catalog	40465716	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	38102678	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	30804565	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEWY BODY DISEASE	—	CTD, Disgenet CTD, Disgenet	30236862	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	37464041, 41233554	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAP2-associated Neurodevelopmental Disorder	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	30236862	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rett syndrome	Uncertain significance	ClinVar Disgenet	—	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
UNIPOLAR DEPRESSION	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
RASGEF1B	4	["Juvenile arthritis","Eye disease","Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis"]	[]	4	["CTD (Juvenile arthritis)","GWAS catalog (Eye disease)","Disgenet (Juvenile idiopathic arthritis)","Disgenet (Oligoarticular juvenile idiopathic arthritis)"]
ADCY7	5	["Juvenile arthritis","Depression","Mood disorder","Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis"]	[]	5	["CTD (Juvenile arthritis)","Disgenet (Depression)","Disgenet (Mood disorder)","Disgenet (Juvenile idiopathic arthritis)","Disgenet (Oligoarticular juvenile idiopathic arthritis)"]
ACP3	3	["Juvenile arthritis","Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis"]	[]	3	["CTD (Juvenile arthritis)","Disgenet (Juvenile idiopathic arthritis)","Disgenet (Oligoarticular juvenile idiopathic arthritis)"]
ACRBP	3	["Juvenile arthritis","Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis"]	[]	3	["CTD (Juvenile arthritis)","Disgenet (Juvenile idiopathic arthritis)","Disgenet (Oligoarticular juvenile idiopathic arthritis)"]
ANKRD9	3	["Juvenile arthritis","Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis"]	[]	3	["CTD (Juvenile arthritis)","Disgenet (Juvenile idiopathic arthritis)","Disgenet (Oligoarticular juvenile idiopathic arthritis)"]

MAP2 (microtubule associated protein 2)

Bookmark This Gene