Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	113
Gene name	Adenylate cyclase 7
Gene symbol	ADCY7
Synonyms (NCBI Gene)	AC7
Chromosome	16
Chromosome location	16q12.1
Summary	This gene encodes a membrane-bound adenylate cyclase that catalyses the formation of cyclic AMP from ATP and is inhibitable by calcium. The product of this gene is a member of the adenylyl cyclase class-4/guanylyl cyclase enzyme family that is characteriz

194

Show/Hide all (194)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018909	hsa-miR-335-5p	Microarray	18185580
MIRT527570	hsa-miR-302f	PAR-CLIP	22012620
MIRT527571	hsa-miR-634	PAR-CLIP	22012620
MIRT527569	hsa-miR-4310	PAR-CLIP	22012620
MIRT527568	hsa-miR-7157-5p	PAR-CLIP	22012620
MIRT527567	hsa-miR-338-3p	PAR-CLIP	22012620
MIRT527566	hsa-miR-938	PAR-CLIP	22012620
MIRT527565	hsa-miR-6886-3p	PAR-CLIP	22012620
MIRT527564	hsa-miR-6501-5p	PAR-CLIP	22012620
MIRT527563	hsa-miR-4423-5p	PAR-CLIP	22012620
MIRT527562	hsa-miR-5590-5p	PAR-CLIP	22012620
MIRT527560	hsa-miR-4659a-5p	PAR-CLIP	22012620
MIRT527561	hsa-miR-4659b-5p	PAR-CLIP	22012620
MIRT527559	hsa-miR-3157-3p	PAR-CLIP	22012620
MIRT527558	hsa-miR-874-3p	PAR-CLIP	22012620
MIRT527557	hsa-miR-744-3p	PAR-CLIP	22012620
MIRT527556	hsa-miR-4776-3p	PAR-CLIP	22012620
MIRT527570	hsa-miR-302f	PAR-CLIP	22012620
MIRT527571	hsa-miR-634	PAR-CLIP	22012620
MIRT527569	hsa-miR-4310	PAR-CLIP	22012620
MIRT527568	hsa-miR-7157-5p	PAR-CLIP	22012620
MIRT527567	hsa-miR-338-3p	PAR-CLIP	22012620
MIRT527566	hsa-miR-938	PAR-CLIP	22012620
MIRT527565	hsa-miR-6886-3p	PAR-CLIP	22012620
MIRT527564	hsa-miR-6501-5p	PAR-CLIP	22012620
MIRT527563	hsa-miR-4423-5p	PAR-CLIP	22012620
MIRT527562	hsa-miR-5590-5p	PAR-CLIP	22012620
MIRT527560	hsa-miR-4659a-5p	PAR-CLIP	22012620
MIRT527561	hsa-miR-4659b-5p	PAR-CLIP	22012620
MIRT527559	hsa-miR-3157-3p	PAR-CLIP	22012620
MIRT527558	hsa-miR-874-3p	PAR-CLIP	22012620
MIRT527557	hsa-miR-744-3p	PAR-CLIP	22012620
MIRT527556	hsa-miR-4776-3p	PAR-CLIP	22012620
MIRT768122	hsa-miR-103a	CLIP-seq
MIRT768123	hsa-miR-107	CLIP-seq
MIRT768124	hsa-miR-1202	CLIP-seq
MIRT768125	hsa-miR-1207-5p	CLIP-seq
MIRT768126	hsa-miR-1225-3p	CLIP-seq
MIRT768127	hsa-miR-127-5p	CLIP-seq
MIRT768128	hsa-miR-1279	CLIP-seq
MIRT768129	hsa-miR-135a	CLIP-seq
MIRT768130	hsa-miR-135b	CLIP-seq
MIRT768131	hsa-miR-147b	CLIP-seq
MIRT768132	hsa-miR-1539	CLIP-seq
MIRT768133	hsa-miR-1909	CLIP-seq
MIRT768134	hsa-miR-210	CLIP-seq
MIRT768135	hsa-miR-24	CLIP-seq
MIRT768136	hsa-miR-3120-3p	CLIP-seq
MIRT768137	hsa-miR-3175	CLIP-seq
MIRT768138	hsa-miR-3614-5p	CLIP-seq
MIRT768139	hsa-miR-3617	CLIP-seq
MIRT768140	hsa-miR-3669	CLIP-seq
MIRT768141	hsa-miR-3943	CLIP-seq
MIRT768142	hsa-miR-3944-5p	CLIP-seq
MIRT768143	hsa-miR-3972	CLIP-seq
MIRT768144	hsa-miR-3978	CLIP-seq
MIRT768145	hsa-miR-4284	CLIP-seq
MIRT768146	hsa-miR-4436b-5p	CLIP-seq
MIRT768147	hsa-miR-4530	CLIP-seq
MIRT768148	hsa-miR-455-5p	CLIP-seq
MIRT768149	hsa-miR-4659a-3p	CLIP-seq
MIRT768150	hsa-miR-4659b-3p	CLIP-seq
MIRT768151	hsa-miR-4712-3p	CLIP-seq
MIRT768152	hsa-miR-4729	CLIP-seq
MIRT768153	hsa-miR-4755-3p	CLIP-seq
MIRT768154	hsa-miR-4762-5p	CLIP-seq
MIRT768155	hsa-miR-4763-3p	CLIP-seq
MIRT768156	hsa-miR-4768-3p	CLIP-seq
MIRT768157	hsa-miR-4789-5p	CLIP-seq
MIRT768158	hsa-miR-520f	CLIP-seq
MIRT768159	hsa-miR-548ac	CLIP-seq
MIRT768160	hsa-miR-548ae	CLIP-seq
MIRT768161	hsa-miR-548aj	CLIP-seq
MIRT768162	hsa-miR-548am	CLIP-seq
MIRT768163	hsa-miR-548d-3p	CLIP-seq
MIRT768164	hsa-miR-548x	CLIP-seq
MIRT768165	hsa-miR-548z	CLIP-seq
MIRT768166	hsa-miR-558	CLIP-seq
MIRT768167	hsa-miR-579	CLIP-seq
MIRT768168	hsa-miR-604	CLIP-seq
MIRT768169	hsa-miR-641	CLIP-seq
MIRT768170	hsa-miR-642b	CLIP-seq
MIRT768171	hsa-miR-647	CLIP-seq
MIRT768172	hsa-miR-665	CLIP-seq
MIRT768144	hsa-miR-3978	CLIP-seq
MIRT768158	hsa-miR-520f	CLIP-seq
MIRT768144	hsa-miR-3978	CLIP-seq
MIRT768158	hsa-miR-520f	CLIP-seq
MIRT768144	hsa-miR-3978	CLIP-seq
MIRT768158	hsa-miR-520f	CLIP-seq
MIRT768144	hsa-miR-3978	CLIP-seq
MIRT768158	hsa-miR-520f	CLIP-seq
MIRT1926578	hsa-miR-539	CLIP-seq
MIRT2167569	hsa-miR-128	CLIP-seq
MIRT2167570	hsa-miR-3144-5p	CLIP-seq
MIRT2167571	hsa-miR-3191	CLIP-seq
MIRT2167572	hsa-miR-3200-5p	CLIP-seq
MIRT2167573	hsa-miR-3663-3p	CLIP-seq
MIRT768144	hsa-miR-3978	CLIP-seq
MIRT2167574	hsa-miR-4269	CLIP-seq
MIRT2167575	hsa-miR-4303	CLIP-seq
MIRT2167576	hsa-miR-4645-5p	CLIP-seq
MIRT2167577	hsa-miR-4652-5p	CLIP-seq
MIRT2167578	hsa-miR-4673	CLIP-seq
MIRT768158	hsa-miR-520f	CLIP-seq
MIRT2443241	hsa-miR-10a	CLIP-seq
MIRT2443242	hsa-miR-10b	CLIP-seq
MIRT2443243	hsa-miR-2276	CLIP-seq
MIRT2443244	hsa-miR-4704-3p	CLIP-seq
MIRT2443245	hsa-miR-4772-3p	CLIP-seq
MIRT2470134	hsa-miR-1207-3p	CLIP-seq
MIRT2470135	hsa-miR-1254	CLIP-seq
MIRT2470136	hsa-miR-1266	CLIP-seq
MIRT2470137	hsa-miR-129-3p	CLIP-seq
MIRT2470138	hsa-miR-1912	CLIP-seq
MIRT2470139	hsa-miR-1915	CLIP-seq
MIRT2470140	hsa-miR-19a	CLIP-seq
MIRT2470141	hsa-miR-19b	CLIP-seq
MIRT2470142	hsa-miR-205	CLIP-seq
MIRT2470143	hsa-miR-2113	CLIP-seq
MIRT768135	hsa-miR-24	CLIP-seq
MIRT2470144	hsa-miR-3065-3p	CLIP-seq
MIRT2470145	hsa-miR-3116	CLIP-seq
MIRT2470146	hsa-miR-3130-5p	CLIP-seq
MIRT2470147	hsa-miR-3156-5p	CLIP-seq
MIRT2470148	hsa-miR-3176	CLIP-seq
MIRT2470149	hsa-miR-337-5p	CLIP-seq
MIRT2470150	hsa-miR-3650	CLIP-seq
MIRT2470151	hsa-miR-371-5p	CLIP-seq
MIRT2470152	hsa-miR-371b-5p	CLIP-seq
MIRT2470153	hsa-miR-3922-3p	CLIP-seq
MIRT2470154	hsa-miR-3925-3p	CLIP-seq
MIRT2470155	hsa-miR-3942-3p	CLIP-seq
MIRT2470156	hsa-miR-3973	CLIP-seq
MIRT2470157	hsa-miR-4252	CLIP-seq
MIRT2470158	hsa-miR-4261	CLIP-seq
MIRT2470159	hsa-miR-4267	CLIP-seq
MIRT2167574	hsa-miR-4269	CLIP-seq
MIRT2470160	hsa-miR-4270	CLIP-seq
MIRT2470161	hsa-miR-4441	CLIP-seq
MIRT2470162	hsa-miR-4482	CLIP-seq
MIRT2470163	hsa-miR-4495	CLIP-seq
MIRT2470164	hsa-miR-4518	CLIP-seq
MIRT2470165	hsa-miR-451b	CLIP-seq
MIRT2167576	hsa-miR-4645-5p	CLIP-seq
MIRT2167578	hsa-miR-4673	CLIP-seq
MIRT2470166	hsa-miR-4690-3p	CLIP-seq
MIRT2470167	hsa-miR-4695-3p	CLIP-seq
MIRT2470168	hsa-miR-4726-3p	CLIP-seq
MIRT2470169	hsa-miR-4738-3p	CLIP-seq
MIRT2470170	hsa-miR-515-5p	CLIP-seq
MIRT2470171	hsa-miR-520g	CLIP-seq
MIRT2470172	hsa-miR-520h	CLIP-seq
MIRT2470173	hsa-miR-543	CLIP-seq
MIRT2470174	hsa-miR-548g	CLIP-seq
MIRT2470175	hsa-miR-561	CLIP-seq
MIRT2470176	hsa-miR-766	CLIP-seq
MIRT2470177	hsa-miR-875-3p	CLIP-seq
MIRT2470136	hsa-miR-1266	CLIP-seq
MIRT2674541	hsa-miR-1294	CLIP-seq
MIRT2470139	hsa-miR-1915	CLIP-seq
MIRT768135	hsa-miR-24	CLIP-seq
MIRT2470147	hsa-miR-3156-5p	CLIP-seq
MIRT2674542	hsa-miR-3180	CLIP-seq
MIRT2674543	hsa-miR-3180-3p	CLIP-seq
MIRT2674544	hsa-miR-3184	CLIP-seq
MIRT2674545	hsa-miR-3196	CLIP-seq
MIRT2470149	hsa-miR-337-5p	CLIP-seq
MIRT2470151	hsa-miR-371-5p	CLIP-seq
MIRT2470152	hsa-miR-371b-5p	CLIP-seq
MIRT2470155	hsa-miR-3942-3p	CLIP-seq
MIRT2470156	hsa-miR-3973	CLIP-seq
MIRT2674546	hsa-miR-423-5p	CLIP-seq
MIRT2470160	hsa-miR-4270	CLIP-seq
MIRT2674547	hsa-miR-4316	CLIP-seq
MIRT2470161	hsa-miR-4441	CLIP-seq
MIRT2674548	hsa-miR-4488	CLIP-seq
MIRT2470164	hsa-miR-4518	CLIP-seq
MIRT2470165	hsa-miR-451b	CLIP-seq
MIRT2470166	hsa-miR-4690-3p	CLIP-seq
MIRT2470167	hsa-miR-4695-3p	CLIP-seq
MIRT2674549	hsa-miR-4697-5p	CLIP-seq
MIRT2470168	hsa-miR-4726-3p	CLIP-seq
MIRT2470171	hsa-miR-520g	CLIP-seq
MIRT2470172	hsa-miR-520h	CLIP-seq
MIRT768159	hsa-miR-548ac	CLIP-seq
MIRT768160	hsa-miR-548ae	CLIP-seq
MIRT768161	hsa-miR-548aj	CLIP-seq
MIRT768162	hsa-miR-548am	CLIP-seq
MIRT768163	hsa-miR-548d-3p	CLIP-seq
MIRT768164	hsa-miR-548x	CLIP-seq
MIRT768165	hsa-miR-548z	CLIP-seq
MIRT768172	hsa-miR-665	CLIP-seq
MIRT2674550	hsa-miR-758	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002819	Process	Regulation of adaptive immune response	IEA
GO:0002819	Process	Regulation of adaptive immune response	ISS
GO:0004016	Function	Adenylate cyclase activity	IBA
GO:0004016	Function	Adenylate cyclase activity	IDA	11113152, 17760784
GO:0004016	Function	Adenylate cyclase activity	IEA
GO:0004016	Function	Adenylate cyclase activity	IMP	18541530, 23178822, 23229509, 23842570
GO:0005524	Function	ATP binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0006171	Process	CAMP biosynthetic process	IBA
GO:0006171	Process	CAMP biosynthetic process	IDA	11113152, 17760784
GO:0006171	Process	CAMP biosynthetic process	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0009190	Process	Cyclic nucleotide biosynthetic process	IEA
GO:0016020	Component	Membrane	IDA	11113152
GO:0016020	Component	Membrane	IEA
GO:0016829	Function	Lyase activity	IEA
GO:0016849	Function	Phosphorus-oxygen lyase activity	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0060135	Process	Maternal process involved in female pregnancy	IEA
GO:0071285	Process	Cellular response to lithium ion	IEA
GO:0071285	Process	Cellular response to lithium ion	ISS
GO:0071361	Process	Cellular response to ethanol	IDA	12454008, 17760784
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IEA
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	ISS

MIM	HGNC	e!Ensembl
600385	238	ENSG00000121281

P51828

Protein name

Adenylate cyclase type 7 (EC 4.6.1.1) (ATP pyrophosphate-lyase 7) (Adenylate cyclase type VII) (Adenylyl cyclase 7)

Protein function

Catalyzes the formation of cAMP in response to activation of G protein-coupled receptors (Probable). Functions in signaling cascades activated namely by thrombin and sphingosine 1-phosphate and mediates regulation of cAMP synthesis through syner

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16214	AC_N	15 → 256	Adenylyl cyclase N-terminal extracellular and transmembrane region	Family
PF00211	Guanylate_cyc	270 → 447	Adenylate and Guanylate cyclase catalytic domain	Domain
PF06327	DUF1053	485 → 593	Domain of Unknown Function (DUF1053)	Family
PF00211	Guanylate_cyc	870 → 1069	Adenylate and Guanylate cyclase catalytic domain	Domain

Sequence

MPAKGRYFLNEGEEGPDQDALYEKYQLTSQHGPLLLTLLLVAATACVALIIIAFSQGDPS
RHQAILGMAFLVLAVFAALSVLMYVECLLRRWLRALALLTWACLVALGYVLVFDAWTKAA
CAWEQVPFFLFIVFVVYTLLPFSMRGAVAVGAVSTASHLLVLGSLMGGFTTPSVRVGLQL
LANAVIFLCGNLTGAFHKHQMQDASRDLFTYTVKCIQIRRKLRIEKRQQENLLLSVLPAH
ISMGMKLAIIERLKEHGDRRCMPDNNFHSLYVKRHQNVSILYADIVGFTQLASDCSPKEL
VVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDMCQAIKQ
VREATGVDINMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITEAT
LKHLDKAYEVEDGHGQQRDPYLKEMNIRTYLVIDPRSQQPPPPSQHLPRPKGDAALKMRA
SVRMTRYLESWGAARPFAHLNHRESVSSGETHVPNGRRPKSVPQRHRRTPDRSMSPKGRS
EDDSYDDEMLSAIEGLSSTRPCCSKSDDFYTFGSIFLEKGFEREYRLAPIPRARHDFACA
SLIFVCILLVHVLLMPRTAALGVSFGLVACVLGLVLGLCFATKFSRCCPARGTLCTISER
VETQPLLRLTLAVLTIGSLLTVAIINLPLMPFQVPELPVGNETGLLAASSKTRALCEPLP
YYTCSCVLGFIACSVFLRMSLEPKVVLLTVALVAYLVLFNLSPCWQWDCCGQGLGNLTKP
NGTTSGTPSCSWKDLKTMTNFYLVLFYITLLTLSRQIDYYCRLDCLWKKKFKKEHEEFET
MENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPDFKVFYTECDVNKE
GLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSVASGHENQELERQHAH
IGVMVEFSIALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVAS
RMESTGELGKIQVTEETCTILQGLGYSCECRGLINVKGKGELRTYFVCTDTAKFQGLGLN

Sequence length

1080

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (27)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, JUVENILE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON VARIABLE IMMUNODEFICIENCY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (48)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	18206229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	18206229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	30366671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26301688		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	22797469	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 1	Autoimmune Diseases	GWASCAT_DG	26301688, 30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 2	Autoimmune Diseases	GWASCAT_DG	26301688, 30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	GWASCAT_DG	26301688, 30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	GWASCAT_DG	26301688		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis Ulcerative	Ulcerative colitis	Pubtator	28067910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	GWASCAT_DG	26301688		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	17135423, 22264442, 30904753		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	17135423, 22264442		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	34555062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	GWASCAT_DG	30595370		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	28067908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28067910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	28067910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	30831289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	26220344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	26220344	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	26220344	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	18206229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26220344, 29938007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	17135423, 22264442		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	17135423, 22264442		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	22264442, 30904753		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	22264442		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	17135423, 9034014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	22264442		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	22264442		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	GWASCAT_DG	26301688		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	21822266		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26301688, 28067908, 28067910		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	BEFREE	28067910		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	CTD_human_DG	28067910		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	17135423, 22264442		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	17135423, 22264442		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

ADCY7 (adenylate cyclase 7)